﻿msgid ""
msgstr ""
"Project-Id-Version: \n"
"POT-Creation-Date: \n"
"PO-Revision-Date: 2007-06-27 17:38+0100\n"
"Last-Translator: Tamás Attila <tamasati@freemail.hu>\n"
"Language-Team: Hungary <lazarus_hungary@freemail.hu>\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=utf-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Poedit-Language: Magyar\n"
"X-Poedit-SourceCharset: utf-8\n"

#: lazarusidestrconsts:srkmcommand1
msgid "    command1 \""
msgstr "   parancs1 \""

#: lazarusidestrconsts:srkmcommand2
msgid "    command2 \""
msgstr "   parancs2 \""

#: lazarusidestrconsts:liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr " A szimbólum %s%s%s már létezik! "

#: lazarusidestrconsts:srkmalreadyconnected
msgid " The key \"%s\" is already connected to \"%s\"."
msgstr " A billentyű \"%s\" már kapcsolatban van \"%s\"."

#: lazarusidestrconsts:srkmconflicw
msgid " conflicts with "
msgstr " űtközés "

#: lazarusidestrconsts:liscompiling
msgid "%s (compiling ...)"
msgstr "%s (Fordítás...)"

#: lazarusidestrconsts:lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (Hibakeresés...)"

#: lazarusidestrconsts:liscovarious
msgid "%s (various)"
msgstr "%s (különböző)"

#: lazarusidestrconsts:lisnewproject
msgid "%s - (new project)"
msgstr "%s - (Új Projekt)"

#: lazarusidestrconsts:lislazarusversionstring
msgid "%s beta"
msgstr "%s Béta"

#: lazarusidestrconsts:lisuidbytes
msgid "%s bytes"
msgstr "%s Byte"

#: lazarusidestrconsts:liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "%s könyvtár"

#: lazarusidestrconsts:lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s már része a Projektnek."

#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "%s Munkakönyvtár"

#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%s érvénytelen projekt név%sKérem válasszon másikat (p.l. project1.lpi)"

#: lazarusidestrconsts:lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr "%s%s%s érvénytelen azonosító."

#: lazarusidestrconsts:lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr "%s%s%s érvénytelen unit név"

#: lazarusidestrconsts:liscoclickokifaresuretodothat
msgid "%s%sClick OK if you are sure to do that."
msgstr "%s%sKlikkelj az OK-ra, ha biztos vagy benne."

#: lazarusidestrconsts:lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr "%s%sFájl név: %s%s%s"

#: lazarusidestrconsts:lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sEz az osztály %s nem változtatható %s"

#: lazarusidestrconsts:lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr "%s%sUnitnév: %s%s%s"

#: lazarusidestrconsts:lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Oldal: %s"

#: lazarusidestrconsts:liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, automatikusan létrehozott"

#: lazarusidestrconsts:liscodetoolsdefsprojectspecific
msgid "%s, project specific"
msgstr "%s, projekt jellemző"

#: lazarusidestrconsts:lisuereadonly
msgid "%s/ReadOnly"
msgstr "%s/Csak olvasható"

#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr "%sAdj új függőséget a csomagnak %s: Csomag %s%s"

#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr "%sAdj új függőséget a Projektnek %s: Csomag %s%s"

#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%smindkét csomag kapcsolatban van. Ez azt jelenti, hogy az egyik csomag használja a másikat, vagy minkettő használ egy harmadikat."

#: lazarusidestrconsts:lisoipdescriptiondescription
msgid "%sDescription:  %s"
msgstr "%sLeírás:  %s"

#: lazarusidestrconsts:lisa2pexistingfile
msgid "%sExisting file: %s%s%s"
msgstr "%sMeglévő fájl: %s%s%s"

#: lazarusidestrconsts:lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sLásd Projekt -> Projektfelügyelő"

#: lazarusidestrconsts:lispckexplstate
msgid "%sState: "
msgstr "%sÁllapot: "

#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr "%sA következő unitok lesznek hozzáadva a felhasználói szekcióhoz%s%s:%s%s%s"

#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "%sEz a csomag telepítve van, de az lpk fájl nincs meg"

#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated
msgid "%sThis package was automatically created"
msgstr "%sEz a csomag automatikusan lett létrehozva"

#: lazarusidestrconsts:lisnone
msgid "%snone"
msgstr "%snincs"

#: lazarusidestrconsts:liswladd
msgid "&Add"
msgstr "&Hozzáadás"

#: lazarusidestrconsts:uemaddbreakpoint
msgid "&Add Breakpoint"
msgstr "M&egszakítási pont hozzáadása"

#: lazarusidestrconsts:lisclose
msgid "&Close"
msgstr "Be&zárás"

#: lazarusidestrconsts:uemclosepage
msgid "&Close Page"
msgstr "&Lap bezárása"

#: lazarusidestrconsts:lismenucomponents
msgid "&Components"
msgstr "K&omponens"

#: lazarusidestrconsts:liswldelete
msgid "&Delete"
msgstr "&Törlés"

#: lazarusidestrconsts:lismenuedit
msgid "&Edit"
msgstr "&Szerkesztés"

#: lazarusidestrconsts:liswlenabled
msgid "&Enabled"
msgstr "&Engedélyezés"

#: lazarusidestrconsts:lismenufile
msgid "&File"
msgstr "&Fájl"

#: lazarusidestrconsts:uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Deklaráció keresés"

#: lazarusidestrconsts:uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Ugrás könyvjelzőre"

#: lazarusidestrconsts:lismenuhelp
msgid "&Help"
msgstr "&Súgó"

#: lazarusidestrconsts:lisplistobjects
msgid "&Objects"
msgstr "&Objektum"

#: lazarusidestrconsts:lisok
msgid "&Ok"
msgstr "&Ok"

#: lazarusidestrconsts:uemopenfileatcursor
msgid "&Open file at cursor"
msgstr "Fájl &megnyitás kurzornál"

#: lazarusidestrconsts:lismenuproject
msgid "&Project"
msgstr "&Projekt"

#: lazarusidestrconsts:liswlproperties
msgid "&Properties"
msgstr "&Tulajdonságok"

#: lazarusidestrconsts:dlgreplacewith
msgid "&Replace With"
msgstr "&Helyettesítés"

#: lazarusidestrconsts:lismenurun
msgid "&Run"
msgstr "&Futtatás"

#: lazarusidestrconsts:uemruntocursor
msgid "&Run to Cursor"
msgstr "F&uttatás kurzorig"

#: lazarusidestrconsts:lismenusearch
msgid "&Search"
msgstr "&Keresés"

#: lazarusidestrconsts:uemsetbookmark
msgid "&Set Bookmark"
msgstr "Új k&önyvjelző"

#: lazarusidestrconsts:dlgtexttofing
msgid "&Text to Find"
msgstr "Szö&veg keresése"

#: lazarusidestrconsts:lismenutools
msgid "&Tools"
msgstr "&Eszközök"

#: lazarusidestrconsts:lismenuview
msgid "&View"
msgstr "&Nézet"

#: lazarusidestrconsts:lismenuwindows
msgid "&Windows"
msgstr "&Ablak"

#: lazarusidestrconsts:liscefilter
msgid "(Filter)"
msgstr "(Szűrő)"

#: lazarusidestrconsts:dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(nem létező alkönyvtár)"

#: lazarusidestrconsts:listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(ismeretlen makro: %s)"

#: lazarusidestrconsts:lisplistall
msgid "<All>"
msgstr "<Minden>"

#: lazarusidestrconsts:lislazdocnotagcaption
msgid "<NONE>"
msgstr "<SEMMI>"

#: lazarusidestrconsts:lisplistnone
msgid "<None>"
msgstr "<Semmi>"

#: lazarusidestrconsts:lisa2pchooseanexistingfile
msgid "<choose an existing file>"
msgstr "<Válasszon egy létező fájlt>"

#: lazarusidestrconsts:lismodifiedlgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""

#: lazarusidestrconsts:lislgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""

#: lazarusidestrconsts:lisgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""

#: lazarusidestrconsts:lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<A kiválasztott nem módosítható>"

#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgstr "%s Rossz osztályválasztás TControl.%sEzzel az osztállyal csak nem vizuális komponenseket lehet készíteni."

#: lazarusidestrconsts:lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr "Ez a fájl  %s%s%s már létezik.%sKicseréli?"

#: lazarusidestrconsts:lispvuapascalunitmusthavetheextensionpporpas
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "A pascal unit kiterjesztése .pp vagy .pas kell legyen"

#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound
msgid "A required packages was not found. See package graph."
msgstr "Egy szükséges csomag nincs meg. Nézze meg a telepített csomagokat!"

#: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
msgstr "Ez egy egyszerű pascal program fájl.%sKönnyen, és gyorsan tesztelhető.%sA legjobban készíthető egy új projekt."

#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr ""

#: lazarusidestrconsts:lispdabort
msgid "Abort"
msgstr "Művelet megszakítva"

#: lazarusidestrconsts:lismenuabortbuild
msgid "Abort Build"
msgstr "Fordítás megszakítása"

#: lazarusidestrconsts:lisabortall
msgid "Abort all"
msgstr "Teljes megszakítás"

#: lazarusidestrconsts:lisabortallloading
msgid "Abort all loading"
msgstr "Minden betöltés megszakítása"

#: lazarusidestrconsts:liskmabortbuilding
msgid "Abort building"
msgstr "Fordítás megszakítása"

#: lazarusidestrconsts:lisabortloadingproject
msgid "Abort loading project"
msgstr "Projekt betöltés megszakítása"

#: lazarusidestrconsts:lisabortwholeloading
msgid "Abort whole loading"
msgstr "Az egység betöltése megszakítva"

#: lazarusidestrconsts:lismenutemplateabout
msgid "About"
msgstr "Névjegy"

#: lazarusidestrconsts:lisaboutlazarus
msgid "About Lazarus"
msgstr "Lazarus névjegye"

#: lazarusidestrconsts:srvk_accept
msgid "Accept"
msgstr "Alkalmaz"

#: lazarusidestrconsts:liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Akció: %s"

#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr ""

#: lazarusidestrconsts:liscodetempladd
msgid "Add"
msgstr "Hozzáadás"

#: lazarusidestrconsts:lisaddtoproject
msgid "Add %s to project?"
msgstr "%s hozzáadás a Projekthez?"

#: lazarusidestrconsts:uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "&Változófigyelő hozzáadása a kurzornál"

#: lazarusidestrconsts:lisa2paddfile
msgid "Add File"
msgstr "Fájl hozzáadása"

#: lazarusidestrconsts:lisa2paddfiles
msgid "Add Files"
msgstr "Fájlok hozzáadása"

#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist
msgid "Add LFM, LRS files, if they exist"
msgstr "LFM- és LRS fájlok hozzáadása, ha létezik"

#: lazarusidestrconsts:lisa2paddunit
msgid "Add Unit"
msgstr "Új Unit"

#: lazarusidestrconsts:lismenuaddcurunittopkg
msgid "Add active unit to a package"
msgstr "Unit hozzáadása a csomaghoz"

#: lazarusidestrconsts:liskmaddactiveunittoproject
msgid "Add active unit to project"
msgstr "Unit hozzáadása a Projekthez"

#: lazarusidestrconsts:lispckeditaddanitem
msgid "Add an item"
msgstr "Elem hozzáadása"

#: lazarusidestrconsts:liskmaddbreakpoint
msgid "Add break point"
msgstr "Megszakítási pont hozzáadása"

#: lazarusidestrconsts:lismenuaddbreakpoint
msgid "Add breakpoint"
msgstr "Új megszakítási pont"

#: lazarusidestrconsts:liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Kódminta hozzáadása"

#: lazarusidestrconsts:lismenuaddtoproject
msgid "Add editor file to Project"
msgstr "Fájl hozzáadása a Projekthez"

#: lazarusidestrconsts:lisprojaddeditorfile
msgid "Add editor files"
msgstr "Fájlok hozzáadása"

#: lazarusidestrconsts:lisaf2paddfiletoapackage
msgid "Add file to a package"
msgstr "Fájl hozzáadása a csomaghoz"

#: lazarusidestrconsts:lisprojaddaddfiletoproject
msgid "Add file to project:"
msgstr "Fájl hozzáadása a projekthez:"

#: lazarusidestrconsts:lisprojaddfiles
msgid "Add files"
msgstr "Fájlok hozzáadása"

#: lazarusidestrconsts:lisa2paddfilestopackage
msgid "Add files to package"
msgstr "Fájlok hozzáadása a csomaghoz"

#: lazarusidestrconsts:srkmecaddjumppoint
msgid "Add jump point"
msgstr "Ugrási pont hozzáadása"

#: lazarusidestrconsts:lismenuaddjumppointtohistory
msgid "Add jump point to history"
msgstr "Ugrási pont hozzáadása az előzményekhez"

#: lazarusidestrconsts:lislazdocaddlinkbutton
msgid "Add link"
msgstr "Új hivatkozás"

#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Új beállítások a függő csomagokhoz, és Projektekhez"

#: lazarusidestrconsts:lislazdocaddpathbutton
msgid "Add path"
msgstr "Új útvonal"

#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Útvonal hozzáadása a függő csomagokhoz/Projektekhez"

#: lazarusidestrconsts:dlgaddsemicolon
msgid "Add semicolon"
msgstr "sorlezárás ( ; ) hozzáadása"

#: lazarusidestrconsts:lisoifaddtofavouriteproperties
msgid "Add to favourite properties"
msgstr "Hozzáadás a kedvenc tulajdonságokhoz"

#: lazarusidestrconsts:lisa2paddtopackage
msgid "Add to package"
msgstr "Hozzáadás a csomaghoz"

#: lazarusidestrconsts:lisprojaddtoproject
msgid "Add to project"
msgstr "Hozzáadás a Projekthez"

#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr ""

#: lazarusidestrconsts:liskmaddwatch
msgid "Add watch"
msgstr "Változófigyelő hozzáadása"

#: lazarusidestrconsts:lismenuaddwatch
msgid "Add watch ..."
msgstr "Változófigyelő hozzáadása..."

#: lazarusidestrconsts:dlgedadd
msgid "Add..."
msgstr "Hozzáad..."

#: lazarusidestrconsts:dlgadditionalsrcpath
msgid "Additional Source search path for all projects (.pp;.pas)"
msgstr "További források keresése minden Projekthez (.pp; .pas)"

#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages
msgid "Additional compiler options inherited from packages"
msgstr "További örökölt fordítóbeállítások a csomagoktól"

#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "További fájlok keresése (pl. *.pas;*.pp)"

#: lazarusidestrconsts:lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Egyéb keresési útvonal"

#: lazarusidestrconsts:dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr ""

#: lazarusidestrconsts:rslanguageafrikaans
msgid "Afrikaans"
msgstr "Afrikaans"

#: lazarusidestrconsts:fdmalignword
msgid "Align"
msgstr "Igazítás"

#: lazarusidestrconsts:lisalignment
msgid "Alignment"
msgstr "Illesztés"

#: lazarusidestrconsts:lisallfiles
msgid "All Files"
msgstr "Minden fájl"

#: lazarusidestrconsts:lisallblockslooksok
msgid "All blocks looks ok."
msgstr "Minden blokk rendben."

#: lazarusidestrconsts:dlgallfiles
msgid "All files"
msgstr "Minden fájl"

#: lazarusidestrconsts:lisedtdefallpackages
msgid "All packages"
msgstr "Minden csomag"

#: lazarusidestrconsts:lisedtdefsallprojects
msgid "All projects"
msgstr "Minden projekt"

#: lazarusidestrconsts:dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "LABEL és GOTO használata"

#: lazarusidestrconsts:lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Összetett keresés"

#: lazarusidestrconsts:dlgalphabetically
msgid "Alphabetically"
msgstr "Abc sorrend"

#: lazarusidestrconsts:lisedtexttoolalt
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts:dlgaltsetclmode
msgid "Alt-Key sets column mode"
msgstr "Alt gomb menü fókusz"

#: lazarusidestrconsts:srkmalternkey
msgid "Alternative key (or 2 keys combination)"
msgstr "Alternatív billentyű (vagy 2 billentyűs kombináció)"

#: lazarusidestrconsts:lisbfalwaysbuildbeforerun
msgid "Always Build before Run"
msgstr "Mindig fordítson futtatás előtt"

#: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Mindig fordítson (módosítás nélkül is)"

#: lazarusidestrconsts:dlgalwaysvisiblecaret
msgid "Always visible caret"
msgstr "Kurzor mindig látszik"

#: lazarusidestrconsts:lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Nem egyértelmű ős típus"

#: lazarusidestrconsts:lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Bizonytalan Osztály Név"

#: lazarusidestrconsts:lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Bizonytalan unit név"

#: lazarusidestrconsts:lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr "Bizonytalan unit létesítés"

#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Bizonytalan járulékos fordító config fájl"

#: lazarusidestrconsts:dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Bizonytalan fájl tevékenység:"

#: lazarusidestrconsts:lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Félreérthető fájl"

#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr "Félreérthető fájl: %s%s%s%sEbben a fájlban hiba található %s%s%s%s%s. Hibás fájl törlése?"

#: lazarusidestrconsts:lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Félreérthető fájl"

#: lazarusidestrconsts:lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Félreérthető Unit"

#: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgstr "Hiba lépett fel az legutóbbi betöltésnél %s!%s%sÚjra betölti a projektet?"

#: lazarusidestrconsts:lisa2pancestortype
msgid "Ancestor Type"
msgstr "Alap Típus"

#: lazarusidestrconsts:lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Objektum Horgony Szerkesztő - ellenőrzés nélkül"

#: lazarusidestrconsts:lisanchortobottomsidekeepborderspace
msgid "Anchor to bottom side of sibling, keep border space"
msgstr "Horgony az alsó oldal csomópontjára, a szegélytérköz megtartásával"

#: lazarusidestrconsts:lisanchortoleftsidekeepborderspace
msgid "Anchor to left side of sibling, keep border space"
msgstr "Horgony a bal oldal csomópontjára, a szegélytérköz megtartásával"

#: lazarusidestrconsts:lisanchortorightsidekeepborderspace
msgid "Anchor to right side of sibling, keep border space"
msgstr "Horgony a jobb oldal csomópontjára, a szegélytérköz megtartásával"

#: lazarusidestrconsts:lisanchortotopsidekeepborderspace
msgid "Anchor to top side of sibling, keep border space"
msgstr "Horgony a felső oldal csomópontjára, a szegélytérköz megtartásával"

#: lazarusidestrconsts:lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Horgony a kijelölt vezérlőre"

#: lazarusidestrconsts:lismakeresstrappendtosection
msgid "Append to section"
msgstr "Hozzárendelés a szekcióhoz"

#: lazarusidestrconsts:dlgpoapplication
msgid "Application"
msgstr "Alkalmazás"

#: lazarusidestrconsts:dlgapplicationsettings
msgid "Application Settings"
msgstr "Alkalmazás beállítások"

#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra
msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
msgstr "Alkalmazás%sEgy grafikus LCL/Free Pascal Program."

#: lazarusidestrconsts:dlgbutapply
msgid "Apply"
msgstr "Alkalmaz"

#: lazarusidestrconsts:lispckeditapplychanges
msgid "Apply changes"
msgstr "Változtatások alkalmazása"

#: lazarusidestrconsts:rslanguagearabic
msgid "Arabic"
msgstr "Arab"

#: lazarusidestrconsts:dlgcoasis
msgid "As-Is"
msgstr "Ahogy van"

#: lazarusidestrconsts:lissortselascending
msgid "Ascending"
msgstr "Növekvő"

#: lazarusidestrconsts:dlgenvask
msgid "Ask"
msgstr "Rákérdez"

#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Rákérdez mielőtt kicseréli a szöveget"

#: lazarusidestrconsts:liscodetoolsoptsat
msgid "At"
msgstr " @ "

#: lazarusidestrconsts:lispckoptsauthor
msgid "Author:"
msgstr "Szerző:"

#: lazarusidestrconsts:dlgautoform
msgid "Auto create form when opening unit"
msgstr "Automatikusan létrehozott form a unit megnyitásakor"

#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgstr "Automatikusan létrehozott csomópontok nem szerkeszthetők,%snem lehetnek automatikusan létrehozott utódcsomópontjaik"

#: lazarusidestrconsts:dlgautodel
msgid "Auto delete file"
msgstr "Automatikus fájl törlés"

#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes can not be edited."
msgstr "Automatikusan létrehozott csomópont nem módosítható."

#: lazarusidestrconsts:dlgautoident
msgid "Auto indent"
msgstr "Automatikus behúzás"

#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Automatikus fordítás, amikor mindent újrafordít"

#: lazarusidestrconsts:dlgautoren
msgid "Auto rename file lowercase"
msgstr "Automatikus fájl átnevezés kisbetűsre"

#: lazarusidestrconsts:dlgautosave
msgid "Auto save"
msgstr "Automatikus mentés"

#: lazarusidestrconsts:dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Automatikusan létrehozott formok:"

#: lazarusidestrconsts:lispckexplautocreated
msgid "AutoCreated"
msgstr "Automatikusan létrehozott"

#: lazarusidestrconsts:rslanguageautomatic
msgid "Automatic (or english)"
msgstr "Automatikus (vagy Angol)"

#: lazarusidestrconsts:lisautomaticfeatures
msgid "Automatic features"
msgstr "Automatikus jellemzők"

#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild
msgid "Automatically increment version on build"
msgstr "Automatikus verziószám emelés fordításkor"

#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Automatikusan telepített csomagok"

#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Automatikus újrafordítás, ha szükséges"

#: lazarusidestrconsts:dlgavailableforms
msgid "Available forms:"
msgstr "Elérhető formok:"

#: lazarusidestrconsts:lisavailablepackages
msgid "Available packages"
msgstr "Elérhető csomagok"

#: lazarusidestrconsts:dlgedback
msgid "Back"
msgstr "Vissza"

#: lazarusidestrconsts:fdmorderbackone
msgid "Back one"
msgstr "Egyet vissza"

#: lazarusidestrconsts:dlgbackcolor
msgid "Background"
msgstr "Háttér"

#: lazarusidestrconsts:srvk_back
msgid "Backspace"
msgstr "Backspace"

#: lazarusidestrconsts:dlgenvbckup
msgid "Backup"
msgstr "Biztonsági mentés"

#: lazarusidestrconsts:lisbackupfilefailed
msgid "Backup file failed"
msgstr "Biztonsági mentés hiányzik"

#: lazarusidestrconsts:lisfrbackwardsearch
msgid "Backward search"
msgstr "Keresés visszafelé"

#: lazarusidestrconsts:dlgbehindmethods
msgid "Behind methods"
msgstr "Rejtett eljárás"

#: lazarusidestrconsts:lispkgfiletypebinary
msgid "Binary"
msgstr "Bináris"

#: lazarusidestrconsts:liscodetoolsdefsblock
msgid "Block"
msgstr "Blokk"

#: lazarusidestrconsts:dlgblockindent
msgid "Block indent"
msgstr "Blokk bekezdés"

#: lazarusidestrconsts:dlgedbold
msgid "Bold"
msgstr "Félkövér"

#: lazarusidestrconsts:uembookmarkn
msgid "Bookmark"
msgstr "Könyvjelző"

#: lazarusidestrconsts:lisborderspace
msgid "BorderSpace"
msgstr "Szegély térköz"

#: lazarusidestrconsts:lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Szegély térköz a vezérlő körül. A másik négy térközt kiadja ez az érték."

#: lazarusidestrconsts:lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Alsó horgony"

#: lazarusidestrconsts:lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Alsó szegélytérköz.  Ez az érték hozzáadódik az alap térközhöz, és alul használja a kontroll."

#: lazarusidestrconsts:lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Alsó hely egyenlő"

#: lazarusidestrconsts:lisbottoms
msgid "Bottoms"
msgstr "Alja értékek"

#: lazarusidestrconsts:dlgbrachighlight
msgid "Bracket highlighting"
msgstr "Zárójel kiemelése"

#: lazarusidestrconsts:lismenubeaklinesinselection
msgid "Break Lines in selection"
msgstr "Új sor beszúrás a kijelölésbe"

#: lazarusidestrconsts:srkmeclinebreak
msgid "Break line and move cursor"
msgstr ""

#: lazarusidestrconsts:srkmecinsertline
msgid "Break line, leave cursor"
msgstr ""

#: lazarusidestrconsts:lisdebugoptionsfrmbreakonlazarusexceptions
msgid "Break on Lazarus Exceptions"
msgstr "Futás megszakítás Lazarus kivételnél"

#: lazarusidestrconsts:lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Megszakítás pontok"

#: lazarusidestrconsts:lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Megszakítás pont"

#: lazarusidestrconsts:lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Megszakított függőségek"

#: lazarusidestrconsts:lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Megszakadt függőség"

#: lazarusidestrconsts:lispatheditbrowse
msgid "Browse"
msgstr "Tallózás"

#: lazarusidestrconsts:lisbrowseforcompiler
msgid "Browse for Compiler (%s)"
msgstr "Fordítóprogram (%s) Keresése"

#: lazarusidestrconsts:lismenubuild
msgid "Build"
msgstr "Fordítás"

#: lazarusidestrconsts:lisbuildcodetools
msgid "Build CodeTools"
msgstr "Kódeszközök Fordítása"

#: lazarusidestrconsts:lisbfbuildcommand
msgid "Build Command"
msgstr "Fordítás parancs"

#: lazarusidestrconsts:lisbuildcomponent
msgid "Build Component"
msgstr "Komponens Fordítása"

#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools
msgid "Build Components (SynEdit, CodeTools)"
msgstr "Komponens Fordítása (SynEdit, CodeTools)"

#: lazarusidestrconsts:lisbuildexamples
msgid "Build Examples"
msgstr "Példa Fordítása"

#: lazarusidestrconsts:lismenubuildfile
msgid "Build File"
msgstr "Fájl Fordítás"

#: lazarusidestrconsts:lisbuildide
msgid "Build IDE"
msgstr "IDE újrafordítás"

#: lazarusidestrconsts:lisbuildideintf
msgid "Build IDE Interface"
msgstr "IDE felület Fordítása"

#: lazarusidestrconsts:lisbuildjitform
msgid "Build JIT Form"
msgstr "JIT-Form Fordítása"

#: lazarusidestrconsts:lislazbuildbuildjitform
msgid "Build JITForm"
msgstr "JIT-Form Fordítása"

#: lazarusidestrconsts:lisbuildlcl
msgid "Build LCL"
msgstr "LCL Fordítása"

#: lazarusidestrconsts:lismenubuildlazarus
msgid "Build Lazarus"
msgstr "Lazarus Fordítása"

#: lazarusidestrconsts:lisbuildnumber
msgid "Build Number"
msgstr "Fordítás szám"

#: lazarusidestrconsts:lisbuildpkgreg
msgid "Build Package Registration"
msgstr "Csomagregisztráció Fordítása"

#: lazarusidestrconsts:lisbuildstarter
msgid "Build Starter"
msgstr "Indítóprogram Fordítása"

#: lazarusidestrconsts:lisbuildsynedit
msgid "Build SynEdit"
msgstr "Synedit Fordítása"

#: lazarusidestrconsts:lismenubuildall
msgid "Build all"
msgstr "Minden fájl fordítása"

#: lazarusidestrconsts:liskmbuildallfilesofprojectprogram
msgid "Build all files of project/program"
msgstr "Minden fájl Fordítása a Projekt/Program-ban"

#: lazarusidestrconsts:srkmecbuildlazarus
msgid "Build lazarus"
msgstr "Lazarus újrafordítása"

#: lazarusidestrconsts:lisbuildnewproject
msgid "Build new project"
msgstr "Új Projekt fordítása"

#: lazarusidestrconsts:liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Projekt/Program Fordítása"

#: lazarusidestrconsts:dlgcmacro
msgid "C Style Macros (global)"
msgstr "C stílusú makrók (global)"

#: lazarusidestrconsts:dlgcocops
msgid "C Style Operators (*=, +=, /= and -=)"
msgstr "C Stílusú operátorok (*=, +=, /= und -=)"

#: lazarusidestrconsts:dlgcppinline
msgid "C++ Styled INLINE"
msgstr "C++ stílusú INLINE"

#: lazarusidestrconsts:lismenuinsertcvskeyword
msgid "CVS keyword"
msgstr "CVS kulcsszó"

#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "%sRegister%s-Prozedur dieser Unit aufrufen"

#: lazarusidestrconsts:lismenuviewcallstack
msgid "Call Stack"
msgstr "Veremhívás"

#: lazarusidestrconsts:liscocallon
msgid "Call on:"
msgstr "Hívás:"

#: lazarusidestrconsts:liscannotcopytoplevelcomponent
msgid "Can not copy top level component."
msgstr "Felső szintű komponens nem másolható."

#: lazarusidestrconsts:liscannotcreatefile
msgid "Can not create file %s%s%s"
msgstr "A fájlt nem lehet létrehozni %s%s%s"

#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit
msgid "Can not register components without unit"
msgstr "Unit nélkül nem regisztrálhatóak a komponensek"

#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Az osztályt változtassa TComponents -re"

#: lazarusidestrconsts:dlgcancel
msgid "Cancel"
msgstr "Mégsem"

#: lazarusidestrconsts:liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Komponens betöltése megszakítva"

#: lazarusidestrconsts:liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Unit betöltése megszakítva"

#: lazarusidestrconsts:liscancelrenaming
msgid "Cancel renaming"
msgstr "Átnevezés megszakítva"

#: lazarusidestrconsts:lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Közreműködő elemek listája nincs meg"

#: lazarusidestrconsts:liscannotfindlazarusstarter
msgid "Cannot find lazarus starter:%s%s"
msgstr "Lazarus indítóprogram nincs meg:%s%s "

#: lazarusidestrconsts:srvk_capital
msgid "Capital"
msgstr "Nagybetű"

#: lazarusidestrconsts:dlgcaretskipsselection
msgid "Caret skips selection"
msgstr "Kurzor átugorja a kijelölést"

#: lazarusidestrconsts:lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Kis- és nagybetű érzéketlen"

#: lazarusidestrconsts:dlgcasesensitive
msgid "Case Sensitive"
msgstr "Kis és nagybetű megkülönböztetés"

#: lazarusidestrconsts:lisfindfilecasesensitive
msgid "Case sensitive"
msgstr "Kis és nagybetű megkülönböztetés"

#: lazarusidestrconsts:rslanguagecatalan
msgid "Catalan"
msgstr "Katalán"

#: lazarusidestrconsts:dlgcentercursorline
msgid "Center Cursor Line"
msgstr ""

#: lazarusidestrconsts:liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling"
msgstr "Kontrollelement horizontal relativ zum angegebenen Geschwister zentrieren"

#: lazarusidestrconsts:liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling"
msgstr "Kontrollelement vertikal relativ zum angegebenen Geschwister zentrieren"

#: lazarusidestrconsts:liscenterinwindow
msgid "Center in window"
msgstr "Ablak közepén"

#: lazarusidestrconsts:liscenters
msgid "Centers"
msgstr "Középpont"

#: lazarusidestrconsts:liscodetemplchange
msgid "Change"
msgstr "Módosít"

#: lazarusidestrconsts:lischangeclass
msgid "Change Class"
msgstr "Osztály módosítás"

#: lazarusidestrconsts:lisplistchangefont
msgid "Change Font"
msgstr "Betűtípus változtatás"

#: lazarusidestrconsts:lischangeparent
msgid "Change parent ..."
msgstr "Szülő módosítás"

#: lazarusidestrconsts:lismenuinsertchangelogentry
msgid "ChangeLog entry"
msgstr "Új log bejegyzés"

#: lazarusidestrconsts:lisdiskdiffchangedfiles
msgid "Changed files:"
msgstr "Módosított fájlok:"

#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Das Ändern des Csomag Namens oder der Version zerstört Abhängigkeiten. Sollen diese Abhängigkeiten ebenfalls geändert werden?%sWählen Sie \"Ja\" um alle aufgeführten Abhängigkeiten zu ändern.%sWählen Sie \"Ignorieren\" um die Abhängigkeiten zu löschen und fortzufahren."

#: lazarusidestrconsts:srkmecchar
msgid "Char"
msgstr "Karakter"

#: lazarusidestrconsts:lischaractermap
msgid "Character Map"
msgstr "Karakter tábla"

#: lazarusidestrconsts:lismenuchecklfm
msgid "Check LFM file in editor"
msgstr "LFM fájl ellenőrzése a szerkesztőablakban"

#: lazarusidestrconsts:lischeckchangesondiskwithloading
msgid "Check changes on disk with loading"
msgstr "Ellenőrizze a változásokat a lemezen"

#: lazarusidestrconsts:dlgcheckconsistency
msgid "Check consistency"
msgstr "Egységesség ellenőrzése"

#: lazarusidestrconsts:dlgcochecks
msgid "Checks:"
msgstr "Ellenőrzések:"

#: lazarusidestrconsts:rslanguagechinese
msgid "Chinese"
msgstr "Kínai"

#: lazarusidestrconsts:lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr ".po fájl könyvtár választása"

#: lazarusidestrconsts:lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Delphi csomag választás"

#: lazarusidestrconsts:lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Delphi-Projekt (*.dpr) választás"

#: lazarusidestrconsts:lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Delphi-Unit (*.pas) választás"

#: lazarusidestrconsts:lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Könyvtár választás"

#: lazarusidestrconsts:lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "FPC forráskönyvtár választás"

#: lazarusidestrconsts:liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Billentyűzet terv kiválasztás"

#: lazarusidestrconsts:lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Lazarus könyvtár választás"

#: lazarusidestrconsts:lisedoptschoosescheme
msgid "Choose Scheme"
msgstr "Terv kiválasztás"

#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty
msgid "Choose a base class for the favourite property %s%s%s."
msgstr "Válasszon alaposztályt a kedvenc tulajdonságnak %s%s%s."

#: lazarusidestrconsts:lischooseadifferentname
msgid "Choose a different name"
msgstr "Más név választása"

#: lazarusidestrconsts:dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Kódminta fájl kiválasztás (*.dci)"

#: lazarusidestrconsts:lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr "Fordító fájlnév kiválasztása (%s)"

#: lazarusidestrconsts:lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr "Hibakereső fájlnév kiválasztása"

#: lazarusidestrconsts:lischoosedirectory
msgid "Choose directory"
msgstr "Könyvtár választás"

#: lazarusidestrconsts:lischoosemakepath
msgid "Choose make path"
msgstr "Make Fájl útvonal kijelölése"

#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Válasszon egyet az elemek közül az új fájl létrehozásához"

#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Válasszon egyet az elemek közül az új csomag létrehozásához"

#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Válasszon egyet az elemek közül az új Projekt létrehozásához"

#: lazarusidestrconsts:lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Programforráskód (*.pp, *.pas, *.lpr) választása"

#: lazarusidestrconsts:lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Válasszon struktúrát a kijelölés körbezárásához"

#: lazarusidestrconsts:lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Válasszon könyvtárat a tesztekhez"

#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies
msgid "Circle in package dependencies"
msgstr "Körfüggés a csomagban"

#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr "Az osztály %s%s%s nem regisztrált komponens osztály.%sNem beilleszthető."

#: lazarusidestrconsts:lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr "Osztály %s%s%s nem létezik."

#: lazarusidestrconsts:lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Ilyen osztálynév már létezik"

#: lazarusidestrconsts:lisclassconflictswithlfmfiletheunitusesthetheunitwhic
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
msgstr "Klassenkonflike mit er .lfm-Fájl:%sDie Unit %s%snutzt die Unit %s%sdie die Klasse %s,%sverwendet, aber die .lfm-Fájl enthält schon eine andere Klasse.%sPro Unit ist nur eine Designklasse erlaubt.%sBitte verschieben Sie %s in eine andere Unit."

#: lazarusidestrconsts:lisclassnotfound
msgid "Class not found"
msgstr "Az osztály nem létezik"

#: lazarusidestrconsts:dlgcdtclassorder
msgid "Class order"
msgstr "Osztály parancs"

#: lazarusidestrconsts:dlgclassinsertpolicy
msgid "Class part insert policy"
msgstr ""

#: lazarusidestrconsts:liskmclassic
msgid "Classic"
msgstr "Klasszikus"

#: lazarusidestrconsts:liscldircleandirectory
msgid "Clean Directory"
msgstr "Könyvtár törlése"

#: lazarusidestrconsts:liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Lazarus forráskód törlése"

#: lazarusidestrconsts:lislazbuildcleanall
msgid "Clean all"
msgstr "Minden törlése"

#: lazarusidestrconsts:lismenucleandirectory
msgid "Clean directory ..."
msgstr "Könyvtár tisztítás ..."

#: lazarusidestrconsts:liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Alkönyvtár tisztítás"

#: lazarusidestrconsts:liscleanupunitpath
msgid "Clean up unit path?"
msgstr "unit útvonal törlése?"

#: lazarusidestrconsts:lislazbuildcleanbuild
msgid "Clean+Build"
msgstr "Törlés és fordítás"

#: lazarusidestrconsts:srvk_clear
msgid "Clear"
msgstr "Töröl"

#: lazarusidestrconsts:lispckeditcleardependencydefaultfilename
msgid "Clear dependency filename"
msgstr "Függő fájlnév törlése"

#: lazarusidestrconsts:lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Include Cache törlése"

#: lazarusidestrconsts:lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Log törlése futtatáskor"

#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Klikkeljen az elemre a különbségek megtekintéséhez"

#: lazarusidestrconsts:lismenuclose
msgid "Close"
msgstr "Bezárás"

#: lazarusidestrconsts:liskmcloseall
msgid "Close All"
msgstr "Minden bezárása"

#: lazarusidestrconsts:lismenucloseproject
msgid "Close Project"
msgstr "Projekt bezárása"

#: lazarusidestrconsts:lismenucloseall
msgid "Close all editor files"
msgstr "Minden szerkesztett fájl bezárása"

#: lazarusidestrconsts:lissrclosepage
msgid "Close page"
msgstr "Lap bezárása"

#: lazarusidestrconsts:liskmcloseproject
msgid "Close project"
msgstr "Projekt bezárás"

#: lazarusidestrconsts:dlgcodegeneration
msgid "Code"
msgstr "Kód"

#: lazarusidestrconsts:lismenuviewcodebrowser
msgid "Code Browser"
msgstr "Kód böngésző"

#: lazarusidestrconsts:dlgcodecreation
msgid "Code Creation"
msgstr "Kód létrehozás"

#: lazarusidestrconsts:lismenuviewcodeexplorer
msgid "Code Explorer"
msgstr "Kód intéző ..."

#: lazarusidestrconsts:lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Kód minta ..."

#: lazarusidestrconsts:dlgcodetoolstab
msgid "Code Tools"
msgstr "Kód Eszközök"

#: lazarusidestrconsts:dlgusecodefolding
msgid "Code folding"
msgstr "Kód szakaszolás"

#: lazarusidestrconsts:dlgedcodeparams
msgid "Code parameters"
msgstr "Kódparaméterek"

#: lazarusidestrconsts:srkmecautocompletion
msgid "Code template completion"
msgstr "Forráskód kiegészítés"

#: lazarusidestrconsts:dlgedcodetempl
msgid "Code templates"
msgstr "Kód minták"

#: lazarusidestrconsts:lisceocodeexplorer
msgid "CodeExplorer Options"
msgstr "Kód intéző beállítások"

#: lazarusidestrconsts:lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
msgstr "Kódeszközök - Eszközök és funkciók a kód elemzéshez, böngészheti és szerkesztheti a forráskódot "

#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Kódeszköz meghatározások szerkesztése"

#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview
msgid "CodeTools Defines Preview"
msgstr "Kódeszközök értelmezés előnézet"

#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Kódeszközök könyvtára"

#: lazarusidestrconsts:dlgcodetoolsopts
msgid "CodeTools Options"
msgstr "Kódeszközök beállítása"

#: lazarusidestrconsts:lismenucodetoolsoptions
msgid "CodeTools Options ..."
msgstr "Kódeszközök beállítása ..."

#: lazarusidestrconsts:srkmcatcodetools
msgid "CodeTools commands"
msgstr "Kódeszköz utasítások"

#: lazarusidestrconsts:liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "Kódeszköz meghatározások szerkesztése"

#: lazarusidestrconsts:lismenucodetoolsdefineseditor
msgid "CodeTools defines editor ..."
msgstr "Kódeszköz meghatározások szerkesztése ..."

#: lazarusidestrconsts:liskmcodetoolsoptions
msgid "CodeTools options"
msgstr "Kódeszközök beállításai"

#: lazarusidestrconsts:srkmeccodetoolsdefinesed
msgid "Codetools defines editor"
msgstr "Kódeszköz meghatározások szerkesztése"

#: lazarusidestrconsts:srkmeccodetoolsoptions
msgid "Codetools options"
msgstr "Kódeszközök beállításai"

#: lazarusidestrconsts:lismenucollectpofil
msgid "Collect .po files"
msgstr ".PO-fájlok gyűjteménye"

#: lazarusidestrconsts:liscodetoolsoptscolon
msgid "Colon"
msgstr "Kettőspont"

#: lazarusidestrconsts:dlgedcolor
msgid "Color"
msgstr "Szín"

#: lazarusidestrconsts:dlgclrscheme
msgid "Color Scheme"
msgstr "Szín módosítás"

#: lazarusidestrconsts:dlgenvcolors
msgid "Colors"
msgstr "Színek"

#: lazarusidestrconsts:srkmeccolumnselect
msgid "Column selection mode"
msgstr "Oszlopkijelölés módja"

#: lazarusidestrconsts:liscodetoolsoptscomma
msgid "Comma"
msgstr "Vessző"

#: lazarusidestrconsts:liscommandafter
msgid "Command after"
msgstr "Utasítás után"

#: lazarusidestrconsts:liscommandafterinvalid
msgid "Command after invalid"
msgstr "Érvénytelen parancs után"

#: lazarusidestrconsts:liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr ""

#: lazarusidestrconsts:srkmcatcmdcmd
msgid "Command commands"
msgstr "Utasításparancsok"

#: lazarusidestrconsts:dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Parancssori paraméterek (alkalmazásnév nélkül)"

#: lazarusidestrconsts:liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Program parancssori paraméterei"

#: lazarusidestrconsts:liscocommand
msgid "Command:"
msgstr "Utasítás:"

#: lazarusidestrconsts:lismenucommentselection
msgid "Comment selection"
msgstr "Kijelölt megjegyzéssé tétele"

#: lazarusidestrconsts:liscodetemplcomment
msgid "Comment:"
msgstr "Megjegyzés:"

#: lazarusidestrconsts:dlgcocompilation
msgid "Compilation"
msgstr "Fordítás"

#: lazarusidestrconsts:liscocalloncompile
msgid "Compile"
msgstr "Fordít"

#: lazarusidestrconsts:liscompileidewithoutlinking
msgid "Compile IDE (without linking)"
msgstr "IDE Fordítás (linkelés nélkül)"

#: lazarusidestrconsts:lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Minden Fordítása?"

#: lazarusidestrconsts:lispckeditcompilepackage
msgid "Compile package"
msgstr "Csomag Fordítása"

#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "Fordítási útvonal hozzáadása"

#: lazarusidestrconsts:liscompiler
msgid "Compiler"
msgstr "Fordító"

#: lazarusidestrconsts:dlgcompileroptions
msgid "Compiler Options"
msgstr "Fordító beállítások"

#: lazarusidestrconsts:lismenucompileroptions
msgid "Compiler Options ..."
msgstr "Fordító beállítások ..."

#: lazarusidestrconsts:lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Fordító beállítások a csomaghoz %s"

#: lazarusidestrconsts:liscompileroptionsforproject
msgid "Compiler Options for Project: %s"
msgstr "Fordító beállítások a Projekthez: %s"

#: lazarusidestrconsts:liscompilererror
msgid "Compiler error"
msgstr "Fordító hiba"

#: lazarusidestrconsts:liscompilerfilename
msgid "Compiler filename"
msgstr "Fordító fájlnév"

#: lazarusidestrconsts:liskmcompileroptions
msgid "Compiler options"
msgstr "Fordító beállítások"

#: lazarusidestrconsts:dlgfpcpath
msgid "Compiler path (e.g. %s)"
msgstr "Fordító útvonal (%s)"

#: lazarusidestrconsts:lismenucompletecode
msgid "Complete Code"
msgstr "Kódgenerálás deklarációból"

#: lazarusidestrconsts:srkmeccompletecode
msgid "Complete code"
msgstr "Kódkiegészítés"

#: lazarusidestrconsts:dlgcompleteproperties
msgid "Complete properties"
msgstr "Tulajdonság kiegészítés"

#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr "A komponensosztály %s%s%s már definiált"

#: lazarusidestrconsts:liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr "A komponensnév %s%s%s kulcsszó"

#: lazarusidestrconsts:liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr "A komponensnév %s%s%s érvénytelen"

#: lazarusidestrconsts:lisfpcomponents
msgid "Components"
msgstr "Komponensek"

#: lazarusidestrconsts:srkmcatcomponentsmenu
msgid "Components menu commands"
msgstr "Komponensek menüparancsai"

#: lazarusidestrconsts:liskmconfigbuildfile
msgid "Config %sBuild File%s"
msgstr "%sBuild Fájl%s einrichten"

#: lazarusidestrconsts:dlgconfigfiles
msgid "Config Files:"
msgstr "Konfigurációs Fájlok:"

#: lazarusidestrconsts:lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr "%sLazarus fordítás%s konfigurálása"

#: lazarusidestrconsts:lisconfigurebuild
msgid "Configure Build %s"
msgstr " %s fordításának konfigurálása"

#: lazarusidestrconsts:lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Fájl Fordítás+Futtatás beállítása ..."

#: lazarusidestrconsts:liskmconfigurehelp
msgid "Configure Help"
msgstr "Súgó beállítása"

#: lazarusidestrconsts:lismenuconfigurehelp
msgid "Configure Help ..."
msgstr "Súgó beállítása ..."

#: lazarusidestrconsts:lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "\"Lazarus fordítás\" beállítása ..."

#: lazarusidestrconsts:liskmconfigurecustomcomponents
msgid "Configure custom components"
msgstr "Szokásos komponens beállítások"

#: lazarusidestrconsts:lismenuconfigcustomcomps
msgid "Configure custom components ..."
msgstr "Szokásos komponens beállítások ..."

#: lazarusidestrconsts:lismenusettings
msgid "Configure custom tools ..."
msgstr "Külső eszköz beállítások ..."

#: lazarusidestrconsts:liskmconfigureinstalledpackages
msgid "Configure installed packages"
msgstr "Installált csomagok beállításai"

#: lazarusidestrconsts:lismenueditinstallpkgs
msgid "Configure installed packages ..."
msgstr "Installált csomagok beállításai ..."

#: lazarusidestrconsts:lislazbuildconfirmbuild
msgid "Confirm Before ReBuild Lazarus"
msgstr "Megerősítés kérése Lazarus újrafordítás előtt"

#: lazarusidestrconsts:lisconfirmchanges
msgid "Confirm changes"
msgstr "Változtatások megerősítése"

#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Megerősítés kérése függőség törlése előtt"

#: lazarusidestrconsts:lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Megerősítés kérése Fájl törlés előtt"

#: lazarusidestrconsts:srkmconflic
msgid "Conflict "
msgstr "Űtközés"

#: lazarusidestrconsts:lispeconflictfound
msgid "Conflict found"
msgstr "Fennálló űtközés"

#: lazarusidestrconsts:dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Konstruktor neve legyen 'init' (Destruktor 'done' kell legyen)"

#: lazarusidestrconsts:lismenutemplatecontents
msgid "Contents"
msgstr "Tartalom"

#: lazarusidestrconsts:lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Tartalomérzékeny súgó"

#: lazarusidestrconsts:liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Tartalomérzékeny súgó"

#: lazarusidestrconsts:liscontinue
msgid "Continue"
msgstr "Folytatás"

#: lazarusidestrconsts:liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Folytatás Form betöltés nélkül"

#: lazarusidestrconsts:liscontributors
msgid "Contributors"
msgstr "Fejlesztők"

#: lazarusidestrconsts:srvk_control
msgid "Control"
msgstr "Vezérlő"

#: lazarusidestrconsts:liscontrolneedsparent
msgid "Control needs parent"
msgstr "A vezérlőnek szülő kell"

#: lazarusidestrconsts:lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Konvertálási beállítások"

#: lazarusidestrconsts:lisconversionerror
msgid "Conversion error"
msgstr "Konvertálási hiba"

#: lazarusidestrconsts:srvk_convert
msgid "Convert"
msgstr "Konvertálás"

#: lazarusidestrconsts:liskmconvertdfmfiletolfm
msgid "Convert DFM file to LFM"
msgstr "DFM fájl konvertálása LFM-re"

#: lazarusidestrconsts:lismenuconvertdfmtolfm
msgid "Convert DFM file to LFM ..."
msgstr "DFM fájl konvertálása ..."

#: lazarusidestrconsts:liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Delphi csomag konvertálás Lazarus csomagra"

#: lazarusidestrconsts:lismenuconvertdelphipackage
msgid "Convert Delphi package to Lazarus package ..."
msgstr "Delphi csomag konvertálás Lazarus csomagra ..."

#: lazarusidestrconsts:liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi project to Lazarus project"
msgstr "Delphi Projekt konvertálás Lazarus projektre"

#: lazarusidestrconsts:lismenuconvertdelphiproject
msgid "Convert Delphi project to Lazarus project ..."
msgstr "Delphi Projekt konvertálás Lazarus projektre ..."

#: lazarusidestrconsts:liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi unit to Lazarus unit"
msgstr "Delphi Unit konvertálás Lazarus Unitra"

#: lazarusidestrconsts:lismenuconvertdelphiunit
msgid "Convert Delphi unit to Lazarus unit ..."
msgstr "Delphi Unit konvertálás Lazarus Unitra ..."

#: lazarusidestrconsts:liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Csomópont konvertálás"

#: lazarusidestrconsts:srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Tabulátor konvertálása szóközre a kijelölésben"

#: lazarusidestrconsts:lismenucopy
msgid "Copy"
msgstr "Másolás"

#: lazarusidestrconsts:liscopyerror
msgid "Copy Error"
msgstr "Másolás hiba"

#: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard
msgid "Copy all and hidden messages to clipboard"
msgstr "Üzenetek elrejtése és minden másolása a vágólapra"

#: lazarusidestrconsts:liscopyallmessagestoclipboard
msgid "Copy all messages to clipboard"
msgstr "Minden üzenet másolása a vágólapra"

#: lazarusidestrconsts:liscopyerror2
msgid "Copy error"
msgstr "Másolás hiba"

#: lazarusidestrconsts:uemcopyfilename
msgid "Copy filename"
msgstr "Fájlnév másolása"

#: lazarusidestrconsts:lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Öröklés másolása"

#: lazarusidestrconsts:lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Metódus név másolása vágólapra"

#: lazarusidestrconsts:liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr "Kijelölt komponens másolása vágólapra"

#: lazarusidestrconsts:lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Kijelölt komponens másolása vágólapra"

#: lazarusidestrconsts:liscopyselectedmessagestoclipboard
msgid "Copy selected messages to clipboard"
msgstr "Kijelölt üzenet másolása vágólapra"

#: lazarusidestrconsts:srkmeccopy
msgid "Copy selection to clipboard"
msgstr "Kijelölés másolása vágólapra"

#: lazarusidestrconsts:dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr ""

#: lazarusidestrconsts:liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "A teljes form másolása nem lehetséges"

#: lazarusidestrconsts:dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Számláló (.pp;1)"

#: lazarusidestrconsts:lisnpcreate
msgid "Create"
msgstr "Létrehozás"

#: lazarusidestrconsts:lismenucreatepofile
msgid "Create .po files"
msgstr ".po fájl létrehozás"

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "Erzeuge Defines für das Verzeichnis %s"

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "Erzeuge Defines für das Projekt %s"

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Létrehozás von Definitionen für den Free Pascal Compiler"

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "Definitionen für Free Pascal SVN forráskód létrehozás"

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir
msgid "Create Defines for Lazarus Directory"
msgstr "Definitionen für Free-Pascal-Verzeichnis Létrehozás"

#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Létrehozás von FPC-Makros und Pfaden für ein FPC-Projektverzeichnis"

#: lazarusidestrconsts:lismenucreatelazdocfiles
msgid "Create LazDoc files"
msgstr "LazDoc Fájl létrehozás"

#: lazarusidestrconsts:lispckeditcreatemakefile
msgid "Create Makefile"
msgstr "MakeFájl létrehozás"

#: lazarusidestrconsts:lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "Almenü létrehozása"

#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained
msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
msgstr "Új cgi alkalmazás létrehozása.%sA programfájlokat a Lazarus támogatja."

#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Új forrásfájl létrehozása.%sVálasszon típust."

#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Új üres text fájl létrehozása."

#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication
msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
msgstr "Egy új grafikus alkalmazás létrehozása.%sA programfájlokat a Lazarus támogatja."

#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit
msgid "Create a new pascal unit."
msgstr "Új Pascal Unit létrehozása"

#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram
msgid "Create a new program."
msgstr "Új Program létrehozása."

#: lazarusidestrconsts:lisnewdlgcreateanewprogram
msgid "Create a new program.%sThe program file is maintained by Lazarus."
msgstr "Új Program létrehozása.%sA programfájlokat a Lazarus támogatja."

#: lazarusidestrconsts:lisnpcreateanewproject
msgid "Create a new project"
msgstr "Új Projekt létrehozása"

#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Új Projekt létrehozása.%sVálasszon egy típust."

#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Új általános Csomag létrehozása.%sA csomag gyűjteménye a unitoknak, és komponenseknek."

#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Új Unit létrehozása egy LCL formmal."

#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Új Unit létrehozása adatmodullal."

#: lazarusidestrconsts:liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Készítsük el az első Projektünket!"

#: lazarusidestrconsts:lisa2pcreatenewfile
msgid "Create new file"
msgstr "Új Fájl létrehozása"

#: lazarusidestrconsts:liscreatenewproject
msgid "Create new project"
msgstr "Új Projekt"

#: lazarusidestrconsts:dlgruberbandcreationcolor
msgid "Creation"
msgstr "Létrehozás"

#: lazarusidestrconsts:lisedtexttoolctrl
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts:lisedtdefcurrentproject
msgid "Current Project"
msgstr "Jelenlegi Projekt"

#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory
msgid "Current Project Directory"
msgstr "Jelenlegi Projekt könyvtár"

#: lazarusidestrconsts:lismenuinsertdatetime
msgid "Current date and time"
msgstr "Jelenlegi dátum és idő"

#: lazarusidestrconsts:lismenuinsertusername
msgid "Current username"
msgstr "Jelenlegi felhasználónév"

#: lazarusidestrconsts:dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Kurzor sor vége után"

#: lazarusidestrconsts:liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Kurzor oszlop az aktuális szerkesztőben"

#: lazarusidestrconsts:srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Kurzor utasításra mozgatása"

#: lazarusidestrconsts:liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Kurzor sor az aktuális szerkesztőben"

#: lazarusidestrconsts:lispckoptscustom
msgid "Custom"
msgstr "Egyéni"

#: lazarusidestrconsts:liscustomprogram
msgid "Custom Program"
msgstr "Egyéni Program"

#: lazarusidestrconsts:liscustomprogramafreepascalprogram
msgid "Custom Program%sA freepascal program."
msgstr "Egyéni Program%sEgy Free Pascal Program."

#: lazarusidestrconsts:liskeycatcustom
msgid "Custom commands"
msgstr "Egyéni utasítások"

#: lazarusidestrconsts:lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Egyéni azonosító"

#: lazarusidestrconsts:liscustomoptions2
msgid "Custom options"
msgstr "Egyéni beállítások"

#: lazarusidestrconsts:rsiwpcustomposition
msgid "Custom position"
msgstr "Egyéni pozició"

#: lazarusidestrconsts:srkmeccustomtool
msgid "Custom tool %d"
msgstr "Egyéni Eszköz %d"

#: lazarusidestrconsts:lismenucut
msgid "Cut"
msgstr "Kivágás"

#: lazarusidestrconsts:liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr "Kijelölt komponens kivágása másolása vágólapra"

#: lazarusidestrconsts:lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Kijelölt komponens kivágása másolása vágólapra"

#: lazarusidestrconsts:srkmeccut
msgid "Cut selection to clipboard"
msgstr "Kijelölés kivágása, másolása vágólapra"

#: lazarusidestrconsts:liswldisableall
msgid "D&isable All"
msgstr "&Minden Letiltása"

#: lazarusidestrconsts:lishlpoptsdatabases
msgid "Databases"
msgstr "Adatbázisok"

#: lazarusidestrconsts:lisdate
msgid "Date"
msgstr "Dátum"

#: lazarusidestrconsts:liswldeleteall
msgid "De&lete All"
msgstr "Minden &Törlése"

#: lazarusidestrconsts:uemdebugword
msgid "Debug"
msgstr "Hibakeresés"

#: lazarusidestrconsts:lismenuviewdebugoutput
msgid "Debug output"
msgstr "Hibakereső kimenete"

#: lazarusidestrconsts:lismenudebugwindows
msgid "Debug windows"
msgstr "Hibakereső Ablakok"

#: lazarusidestrconsts:lismendebuggeroptions
msgid "Debugger Options ..."
msgstr "Hibakereső Beállítások ..."

#: lazarusidestrconsts:lisdebuggererror
msgid "Debugger error"
msgstr "Hibakereső Hiba"

#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Debuggerfehler%sDer Debugger ist abgestürzt.%sSpeichern Sie Ihre Arbeit!%sDrücken Sie \"Ok\" und hoffen Sie auf einen Fix für diesen Bug."

#: lazarusidestrconsts:lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Hibakereső általános beállítások"

#: lazarusidestrconsts:lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Érvénytelen hibakereső"

#: lazarusidestrconsts:dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Hibakereső útvonal (semmi):"

#: lazarusidestrconsts:lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Hibakereső specifikus beállítások (abhängig vom Typ des Debuggers)"

#: lazarusidestrconsts:dlgdebugtype
msgid "Debugger type and path"
msgstr "Hibakereső típus és elérési útvonal"

#: lazarusidestrconsts:dlgcodebugging
msgid "Debugging:"
msgstr "Hibakeresés:"

#: lazarusidestrconsts:rsiwpdefault
msgid "Default"
msgstr "Alapértelmezett"

#: lazarusidestrconsts:dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Alapértelmezett betűtípus"

#: lazarusidestrconsts:dlgpasext
msgid "Default pascal extension"
msgstr "Alapértelmezett pascal kiterjesztés"

#: lazarusidestrconsts:dlgdefvaluecolor
msgid "Default value"
msgstr "Alapértelmezett érték"

#: lazarusidestrconsts:liscodetoolsdefsdefine
msgid "Define"
msgstr "Meghatározás"

#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Rekurzív Definiálás"

#: lazarusidestrconsts:lisctdefdefinetemplates
msgid "Define templates"
msgstr "Sablonok meghatározása"

#: lazarusidestrconsts:dlgeddelay
msgid "Delay"
msgstr "Késleltetés"

#: lazarusidestrconsts:dlgeddelete
msgid "Delete"
msgstr "Törlés"

#: lazarusidestrconsts:lismenueditordeletefromtemplate
msgid "Delete From Template..."
msgstr "Törlés a Sablonból..."

#: lazarusidestrconsts:lismenueditordeleteitem
msgid "Delete Item"
msgstr "Elem Törlése"

#: lazarusidestrconsts:srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Utolsó Karakter Törlése"

#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Régi Csomagfájl Törlése?"

#: lazarusidestrconsts:lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "E fájlok Törlése?"

#: lazarusidestrconsts:lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Bizonytalan Fájlok Törlése?"

#: lazarusidestrconsts:srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Karakter törlése a kurzornál"

#: lazarusidestrconsts:srkmecdeleteline
msgid "Delete current line"
msgstr "Aktuális sor törlése"

#: lazarusidestrconsts:lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr " %s függőségeinek törlése?"

#: lazarusidestrconsts:lispkgmangdeletefailed
msgid "Delete failed"
msgstr "Törlés nem lehetséges"

#: lazarusidestrconsts:lisdeletefilefailed
msgid "Delete file failed"
msgstr "Fájl törlése nem lehetséges"

#: lazarusidestrconsts:liskmdeletelastchar
msgid "Delete last char"
msgstr "Utolsó karakter törlése"

#: lazarusidestrconsts:lislazdocdeletelinkbutton
msgid "Delete link"
msgstr "Hivatkozás törlése"

#: lazarusidestrconsts:liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Csomópont törlése"

#: lazarusidestrconsts:lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr "Régi fájl %s%s%s törlése?"

#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr "Régi csomagfájl %s%s%s törlése?"

#: lazarusidestrconsts:fdmdeleteselection
msgid "Delete selection"
msgstr "Kijelölt törlése"

#: lazarusidestrconsts:dlgdeltemplate
msgid "Delete template"
msgstr "Minta törlése"

#: lazarusidestrconsts:srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Törlés a sor elejétől"

#: lazarusidestrconsts:srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Törlés a sor végéig"

#: lazarusidestrconsts:srkmecdeleteword
msgid "Delete to end of word"
msgstr "Törlés a kifejezés végéig"

#: lazarusidestrconsts:srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Törlés a kezdő kifejezésig"

#: lazarusidestrconsts:srkmecclearall
msgid "Delete whole text"
msgstr "Az egész szöveg törlése"

#: lazarusidestrconsts:lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr "Fájl törlése %s%s%s nem lehetséges."

#: lazarusidestrconsts:dlgdelphi2ext
msgid "Delphi 2 Extensions"
msgstr "Delphi 2 Kiterjesztések"

#: lazarusidestrconsts:dlgdeplhicomp
msgid "Delphi Compatible"
msgstr "Delphi Kompatibilis"

#: lazarusidestrconsts:lisdelphiproject
msgid "Delphi project"
msgstr "Delphi Projekt"

#: lazarusidestrconsts:lisa2pdependency
msgid "Dependency"
msgstr "Függőség"

#: lazarusidestrconsts:lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Fügőségi tulajdonságok"

#: lazarusidestrconsts:lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "A függőség már létezik"

#: lazarusidestrconsts:lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Függőség tulajdonos nélkül: %s"

#: lazarusidestrconsts:lissortseldescending
msgid "Descending"
msgstr "Csökkenő"

#: lazarusidestrconsts:listodoldescription
msgid "Description"
msgstr "Leírás"

#: lazarusidestrconsts:lispckoptsdescriptionabstract
msgid "Description/Abstract"
msgstr "Leírás/Összefoglalás"

#: lazarusidestrconsts:liscodetoolsdefsdescription
msgid "Description:"
msgstr "Leírás:"

#: lazarusidestrconsts:lisoipdescription
msgid "Description:  "
msgstr "Leírás:"

#: lazarusidestrconsts:liskeycatdesigner
msgid "Designer commands"
msgstr "Szerkesztő parancsok"

#: lazarusidestrconsts:lispckoptsdesigntimeandruntime
msgid "Designtime and Runtime"
msgstr "Szerkesztési és Futási idő"

#: lazarusidestrconsts:lispckoptsdesigntimeonly
msgid "Designtime only"
msgstr "Csak szerkesztési időben"

#: lazarusidestrconsts:dlgdesktop
msgid "Desktop"
msgstr "Asztal"

#: lazarusidestrconsts:dlgdesktopfiles
msgid "Desktop files"
msgstr "Asztalfájlok"

#: lazarusidestrconsts:lisaf2pdestinationpackage
msgid "Destination Package"
msgstr "Cél Csomag"

#: lazarusidestrconsts:lisdestinationdirectory
msgid "Destination directory"
msgstr "Célkönyvtár"

#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
msgstr "Célkönyvtár %s%s%s érvénytelen.%sKérem válasszon egy teljes útvonalat."

#: lazarusidestrconsts:lismenudiff
msgid "Diff"
msgstr "Különbség"

#: lazarusidestrconsts:liskmdiffeditorfiles
msgid "Diff editor files"
msgstr "Szerkesztett fájlok különbségei"

#: lazarusidestrconsts:dlgdirection
msgid "Direction"
msgstr "Irány"

#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Könyvtár"

#: lazarusidestrconsts:dlgdirectorydoesnotexist
msgid "Directory does not exist"
msgstr "Könyvtár nincs meg"

#: lazarusidestrconsts:dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Teszt Projekt könyvtára"

#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Könyvtár nincs meg"

#: lazarusidestrconsts:lisfindfiledirectoryoptions
msgid "Directory options"
msgstr "Könyvtár beállítások"

#: lazarusidestrconsts:lisdiscardchanges
msgid "Discard changes"
msgstr "Változtatások elvetése"

#: lazarusidestrconsts:dlgeddisplay
msgid "Display"
msgstr "Képernyő"

#: lazarusidestrconsts:dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Display (nicht bei Win32, beispielsweise 198.112.45.11:0, x.org:1, hydra:0,1)"

#: lazarusidestrconsts:dlglnumsbct
msgid "Display Line Numbers in Run-time Error Backtraces"
msgstr ""

#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Kis és nagybetű megkülönböztetése"

#: lazarusidestrconsts:dlgcfdividerdrawlevel
msgid "Divider Draw Level"
msgstr "Elválasztó vonal szint"

#: lazarusidestrconsts:lisdonotclosetheide
msgid "Do not close the IDE"
msgstr "Ne zárja be az IDE-t"

#: lazarusidestrconsts:lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Ne zárja be a Projektet"

#: lazarusidestrconsts:lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Ne mentse a folyamatot"

#: lazarusidestrconsts:lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "Ne jelenjen meg az indítási kép"

#: lazarusidestrconsts:lisuedonotsho
msgid "Do not show this message again."
msgstr "Ez az üzenet ne jelenjen meg ismét"

#: lazarusidestrconsts:dlgnotsplitlinefront
msgid "Do not split line In front of:"
msgstr ""

#: lazarusidestrconsts:dlgnotsplitlineafter
msgid "Do not split line after:"
msgstr "Zeile nicht teilen nach:"

#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Elveti a változtatásokat a csomaghoz %s és újra betölti a fájlt?"

#: lazarusidestrconsts:lisconfirmlazarusrebuild
msgid "Do you want to rebuild Lazarus?"
msgstr "Lazarus Újrafordítása?"

#: lazarusidestrconsts:rsiwpdocked
msgid "Docked"
msgstr "Dokkolva"

#: lazarusidestrconsts:lisdocumentationeditor
msgid "Documentation Editor"
msgstr "Dokumentáció szerkesztő"

#: lazarusidestrconsts:lislazdocnodocumentation
msgid "Documentation entry does not exist"
msgstr "Dokumentáció bejegyzése nincs meg"

#: lazarusidestrconsts:lissortseldomain
msgid "Domain"
msgstr "Domain"

#: lazarusidestrconsts:dlgdoubleclickline
msgid "Double click line"
msgstr "Duplakattintás a soron"

#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick
msgid "Double click on messages jumps (otherwise: single click)"
msgstr "Duplakattintásra üzenetre ugrik (Alapbeállítás: egy kattintás)"

#: lazarusidestrconsts:dlgdownword
msgid "Down"
msgstr "Le"

#: lazarusidestrconsts:dlgdragdroped
msgid "Drag Drop editing"
msgstr "Fogd és ejtsd szerkesztés"

#: lazarusidestrconsts:dlgdropfiles
msgid "Drop files"
msgstr "Fájlok ledobása"

#: lazarusidestrconsts:lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgstr "Egyforma nevek: A komponens neve %s%s%s az örökölt komponensben már létezik %s"

#: lazarusidestrconsts:rslanguagedutch
msgid "Dutch"
msgstr "Holland"

#: lazarusidestrconsts:liswlenableall
msgid "E&nable All"
msgstr "Összes enge&délyezése"

#: lazarusidestrconsts:lismenuenvironent
msgid "E&nvironment"
msgstr "&Beállítás"

#: lazarusidestrconsts:liscodetoolsdefsedit
msgid "Edit"
msgstr "Szerkesztés"

#: lazarusidestrconsts:liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Kódminták szerkesztése"

#: lazarusidestrconsts:lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr "Általános beállítások szerkesztése"

#: lazarusidestrconsts:srkmeditkeys
msgid "Edit Keys"
msgstr "Szerkesztő billentyűk"

#: lazarusidestrconsts:lispckediteditoptionstocompilepackage
msgid "Edit Options to compile package"
msgstr "Csomag Kompilierungseinstellungen"

#: lazarusidestrconsts:lisedtexttooledittool
msgid "Edit Tool"
msgstr "Szerkesztő eszköz"

#: lazarusidestrconsts:liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Szerkesztett kódminta"

#: lazarusidestrconsts:lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Tartalomérzékeny súgó szerkesztése"

#: lazarusidestrconsts:liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Tartalomérzékeny súgó szerkesztése"

#: lazarusidestrconsts:srkmeditforcmd
msgid "Edit keys for command"
msgstr "Billentyű parancsok szerkesztése"

#: lazarusidestrconsts:lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Virtuális Unit szerkesztése"

#: lazarusidestrconsts:dlgededit
msgid "Edit..."
msgstr "Szerkesztés..."

#: lazarusidestrconsts:dlgedfiles
msgid "Editor files"
msgstr "Szerkesztett fájlok"

#: lazarusidestrconsts:dlgeditorfont
msgid "Editor font"
msgstr "Betűtipus"

#: lazarusidestrconsts:dlgeditorfontheight
msgid "Editor font height"
msgstr "Betű magasság"

#: lazarusidestrconsts:liskmeditoroptions
msgid "Editor options"
msgstr "Szerkesztő beállítások"

#: lazarusidestrconsts:lismenueditoroptions
msgid "Editor options ..."
msgstr "Szerkesztő beállítások ..."

#: lazarusidestrconsts:uemeditorproperties
msgid "Editor properties"
msgstr "Szerkesztő beállítások"

#: lazarusidestrconsts:dlgedelement
msgid "Element"
msgstr "Elemek"

#: lazarusidestrconsts:liscodetoolsdefselse
msgid "Else"
msgstr "Else"

#: lazarusidestrconsts:liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"

#: lazarusidestrconsts:lisenablemacros
msgid "Enable Macros"
msgstr "Makrók engedélyezve"

#: lazarusidestrconsts:lisenabled
msgid "Enabled"
msgstr "Engedélyezve"

#: lazarusidestrconsts:lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr "Engedélyezve = %s Objektum horgony beillesztés"

#: lazarusidestrconsts:lisenclose
msgid "Enclose"
msgstr "Körülzár"

#: lazarusidestrconsts:uemencloseselection
msgid "Enclose Selection"
msgstr "Kijelölés struktúrába zárása"

#: lazarusidestrconsts:liskmencloseselection
msgid "Enclose selection"
msgstr "Kijelölés struktúrába zárása"

#: lazarusidestrconsts:lismenuencloseselection
msgid "Enclose selection ..."
msgstr "Kijelölés struktúrába zárása ..."

#: lazarusidestrconsts:srvk_end
msgid "End"
msgstr "Vége"

#: lazarusidestrconsts:rslanguageenglish
msgid "English"
msgstr "Angol"

#: lazarusidestrconsts:lismacropromptenterdata
msgid "Enter data"
msgstr "Adatbeadás"

#: lazarusidestrconsts:lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Futtatási paraméterek megadása"

#: lazarusidestrconsts:lisentertransla
msgid "Enter translation language"
msgstr "Übersetzungssprache angeben"

#: lazarusidestrconsts:dlgentirescope
msgid "Entire Scope"
msgstr "Gesamter Bereich"

#: lazarusidestrconsts:dlgrunoenvironment
msgid "Environment"
msgstr "Fejlesztő környezet"

#: lazarusidestrconsts:srkmcatenvmenu
msgid "Environment menu commands"
msgstr "Fejlesztőkörnyezet menüparancsok"

#: lazarusidestrconsts:lismenugeneraloptions
msgid "Environment options ..."
msgstr "Fejlesztő környezet beállítások ..."

#: lazarusidestrconsts:liscodetemplerror
msgid "Error"
msgstr "Hiba"

#: lazarusidestrconsts:lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Csomagolvasási hiba"

#: lazarusidestrconsts:lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Csomag írási hiba"

#: lazarusidestrconsts:lisiecoerroraccessingxml
msgid "Error accessing xml"
msgstr "XML hozzáférési hiba"

#: lazarusidestrconsts:lisiecoerroraccessingxmlfile
msgid "Error accessing xml file %s%s%s:%s%s"
msgstr "XML fájl hozzáférési hiba %s%s%s:%s%s"

#: lazarusidestrconsts:liserrorcreatingfile
msgid "Error creating file"
msgstr "Fájl létrehozási hiba "

#: lazarusidestrconsts:liserrorcreatinglrs
msgid "Error creating lrs"
msgstr "Fehler beim Létrehozás der lrs-Fájl"

#: lazarusidestrconsts:liserrordeletingfile
msgid "Error deleting file"
msgstr "Fájl törlési hiba"

#: lazarusidestrconsts:liserrorin
msgid "Error in %s"
msgstr "Hiba %s"

#: lazarusidestrconsts:lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Hiba a reguláris kifejezésben"

#: lazarusidestrconsts:liserrorinitializingprogramserrors
msgid "Error initializing program%s%s%s%s%sError: %s"
msgstr "Fehler beim Initialisieren des Programms%s%s%s%s%sFehler: %s"

#: lazarusidestrconsts:lisiecoerrorloadingxml
msgid "Error loading xml"
msgstr "XML betöltési hiba"

#: lazarusidestrconsts:lisiecoerrorloadingxmlfile
msgid "Error loading xml file %s%s%s:%s%s"
msgstr "Hiba az XML fájl betöltésekor %s%s%s:%s%s"

#: lazarusidestrconsts:liserrormovingcomponent
msgid "Error moving component"
msgstr "Komponens áthelyezési hiba"

#: lazarusidestrconsts:liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Komponens áthelyezési hiba %s:%s"

#: lazarusidestrconsts:liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "lfm elemzési hiba."

#: lazarusidestrconsts:liscodetoolsdefserrorreading
msgid "Error reading %s%s%s%s%s"
msgstr "Olvasási hiba %s%s%s%s%s"

#: lazarusidestrconsts:lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Fájl olvasási hiba"

#: lazarusidestrconsts:lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "Fájl olvasási hiba: %s"

#: lazarusidestrconsts:liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr "Fehler beim Lesen der Csomag Liste aus der Fájl%s%s%s%s"

#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile
msgid "Error reading project info file %s%s%s%s%s"
msgstr "Fehler beim Lesen der Projektinfo-Fájl %s%s%s%s%s"

#: lazarusidestrconsts:liserrorrenamingfile
msgid "Error renaming file"
msgstr "Fájl átnevezési hiba"

#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting
msgid "Error while writing %s%s%s%s%s"
msgstr "Hiba az írás alatt %s%s%s%s%s"

#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile
msgid "Error while writing project info file %s%s%s%s%s"
msgstr "Fehler beim Schreiben der ProjekteinstellungsFájl %s%s%s%s%s"

#: lazarusidestrconsts:lispkgmangerrorwritingfile
msgid "Error writing file"
msgstr "Fájl írási hiba"

#: lazarusidestrconsts:liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr "Fehler beim Schreiben der Csomag Liste in die Fájl%s%s%s%s"

#: lazarusidestrconsts:liserror
msgid "Error: "
msgstr "Hiba:"

#: lazarusidestrconsts:liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Hiba: érvénytelen fordítóprogram: %s"

#: lazarusidestrconsts:liserrors
msgid "Errors"
msgstr "Hibák"

#: lazarusidestrconsts:srvk_escape
msgid "Escape"
msgstr "Escape"

#: lazarusidestrconsts:liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Kiértékelés/Módosítás"

#: lazarusidestrconsts:lismenuevaluate
msgid "Evaluate/Modify ..."
msgstr "Kiértékelés/Módosítás"

#: lazarusidestrconsts:lisdebugoptionsfrmeventlog
msgid "Event Log"
msgstr "Eseménynapló"

#: lazarusidestrconsts:lislazdocexampletag
msgid "Example"
msgstr "Példa"

#: lazarusidestrconsts:lisexcludefilter
msgid "Exclude Filter"
msgstr "Kizáró szűrő"

#: lazarusidestrconsts:srvk_execute
msgid "Execute"
msgstr "Végrehajtás"

#: lazarusidestrconsts:liscoexecuteafter
msgid "Execute after"
msgstr "Végrehajtás után"

#: lazarusidestrconsts:liscoexecutebefore
msgid "Execute before"
msgstr "Végrehajtás előtt"

#: lazarusidestrconsts:lisexecutingcommandafter
msgid "Executing command after"
msgstr "Utasítás végrehajtás után"

#: lazarusidestrconsts:lisexecutingcommandbefore
msgid "Executing command before"
msgstr "Utasítás végrehajtás előtt"

#: lazarusidestrconsts:lisexecutionpaused
msgid "Execution paused"
msgstr "Végrehajtás felfüggesztve"

#: lazarusidestrconsts:lisexecutionpausedadress
msgid "Execution paused%s  Adress: $%s%s  Procedure: %s%s  File: %s%s(Some day an assembler window might popup here :)%s"
msgstr "Végrehajtás felfüggesztve%sCím: $%s%sEljárás: %s%sFájl:%s%s(Néhanapján egy assembler ablak bukkan fel itt :)%s"

#: lazarusidestrconsts:lisexecutionstopped
msgid "Execution stopped"
msgstr "Végrehajtás leállítva"

#: lazarusidestrconsts:lisexecutionstoppedon
msgid "Execution stopped%s"
msgstr "Végrehajtás leállítva%s"

#: lazarusidestrconsts:liscodetoolsdefsexit
msgid "Exit"
msgstr "Kilépés"

#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Kilépés mentés nélkül"

#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr ""

#: lazarusidestrconsts:lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "Die exportierte Fájl %s%s%s ist. vorhanden.%sSoll die Fájl geöffnet und nur die Compiler-Optionen ersetzt werden?%s(Andere Einstellungen bleiben erhalten.)"

#: lazarusidestrconsts:lisiecoexportfileexists
msgid "Export file exists"
msgstr "Export Fájl létezik"

#: lazarusidestrconsts:lisexportlist
msgid "Export list"
msgstr "Export Lista"

#: lazarusidestrconsts:liswlexpression
msgid "Expression"
msgstr "Kifejezés"

#: lazarusidestrconsts:lisextendunitpath
msgid "Extend unit path?"
msgstr "Kiterjesztett unit útvonal?"

#: lazarusidestrconsts:liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Külső eszközök beállításai"

#: lazarusidestrconsts:srkmecexttool
msgid "External tool %d"
msgstr "Külső eszközök %d"

#: lazarusidestrconsts:lisexttoolexternaltools
msgid "External tools"
msgstr "Külső eszközök"

#: lazarusidestrconsts:srkmecexttoolsettings
msgid "External tools settings"
msgstr "Külső eszközök beállításai"

#: lazarusidestrconsts:dlgextralinespacing
msgid "Extra line spacing"
msgstr "Külön sorköz"

#: lazarusidestrconsts:lisextract
msgid "Extract"
msgstr "Kiemelés"

#: lazarusidestrconsts:uemextractproc
msgid "Extract Procedure"
msgstr "Eljárás Kiemelés"

#: lazarusidestrconsts:srkmecextractproc
msgid "Extract procedure"
msgstr "Eljárás Kiemelés"

#: lazarusidestrconsts:lismenuextractproc
msgid "Extract procedure ..."
msgstr "Eljárás Kiemelés ..."

#: lazarusidestrconsts:lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "FPC-Doc-HTML Útvonal"

#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "FPC-SVN Forrás könyvtár"

#: lazarusidestrconsts:lisfpcsourcedirectoryerror
msgid "FPC Source Directory error"
msgstr "FPC Forrás könyvtár hiba"

#: lazarusidestrconsts:dlgfpcsrcpath
msgid "FPC source directory"
msgstr "FPC Forrás könyvtár"

#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg
msgid "FPC source directory \"%s\" not found."
msgstr "FPC Forrás könyvtár \"%s\" nincs meg."

#: lazarusidestrconsts:lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr "Az eszköz nem futtatható"

#: lazarusidestrconsts:dlgcofast
msgid "Faster Code"
msgstr "Gyors kód"

#: lazarusidestrconsts:listodolfile
msgid "File"
msgstr "Fájl"

#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject
msgid "File %s%s%s already exists in the project."
msgstr "A Fájl %s%s%s már a Projekt része."

#: lazarusidestrconsts:lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr "A Fájl %s%s%s megváltozott. Mented?"

#: lazarusidestrconsts:lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr "A Fájl %s%s%s virtuális."

#: lazarusidestrconsts:lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr "A Fájl %s%s%s nincs meg."

#: lazarusidestrconsts:lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr "A Fájl %s%s%s nincs meg.%s"

#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr "A Fájl %s%s%s nincs meg.%sLétrehozza?%s"

#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "A fájl %s%s%s%s nem text fájl.%sMindenképpen megnyitja?"

#: lazarusidestrconsts:lispckeditfileproperties
msgid "File Properties"
msgstr "Fájl tulajdonságok"

#: lazarusidestrconsts:lisaf2pfiletype
msgid "File Type"
msgstr "Fájl Típus"

#: lazarusidestrconsts:lisa2pfilealreadyexists
msgid "File already exists"
msgstr "A fájl már létezik"

#: lazarusidestrconsts:lisa2pfilealreadyinpackage
msgid "File already in package"
msgstr "A fájl már a csomagban van"

#: lazarusidestrconsts:dlgfileexts
msgid "File extensions"
msgstr "Fájl kiterjesztés"

#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "A fájl már a csomagban van"

#: lazarusidestrconsts:lispkgmangfileisinproject
msgid "File is in Project"
msgstr "A fájl a projekt része"

#: lazarusidestrconsts:lisfileisnotwritable
msgid "File is not writable"
msgstr "A fájl nem írható"

#: lazarusidestrconsts:uefilerocap
msgid "File is readonly"
msgstr "A fájl csak olvasható"

#: lazarusidestrconsts:lisa2pfileisused
msgid "File is used"
msgstr "A fájl használatban van"

#: lazarusidestrconsts:lisfindfilefilemaskbak
msgid "File mask (*;*.*;*.bak?)"
msgstr "Fájl maszk (*;*.*;*.bak?)"

#: lazarusidestrconsts:srkmcatfilemenu
msgid "File menu commands"
msgstr "Fájl menü parancs"

#: lazarusidestrconsts:lisa2pfilename
msgid "File name:"
msgstr "Fájl név:"

#: lazarusidestrconsts:lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "A fájl nem futtatható"

#: lazarusidestrconsts:lisfilenotfound
msgid "File not found"
msgstr "Fájl nincs meg"

#: lazarusidestrconsts:lisfilenotlowercase
msgid "File not lowercase"
msgstr "A fájlnév nem kisbetűs"

#: lazarusidestrconsts:lispkgmangfilenotsaved
msgid "File not saved"
msgstr "A fájl nincs mentve"

#: lazarusidestrconsts:lisfilenottext
msgid "File not text"
msgstr "Nem Text Fájl"

#: lazarusidestrconsts:lisa2pfilenotunit
msgid "File not unit"
msgstr "Nem Unit Fájl"

#: lazarusidestrconsts:lisa2pfilename2
msgid "Filename"
msgstr "Fájl név"

#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "A fájl neve különbözik a csomagnévtől"

#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "A fájlnevet használja egy másik csomag"

#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "A fájlnevet használja a projekt"

#: lazarusidestrconsts:lispefilename
msgid "Filename:"
msgstr "Fájl név:"

#: lazarusidestrconsts:lisoipfilename
msgid "Filename:  %s"
msgstr "Fájl név: %s"

#: lazarusidestrconsts:dlgenvfiles
msgid "Files"
msgstr "Fájlok"

#: lazarusidestrconsts:lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Filtern, wenn ein beliebiger Bereich der Methode paßt"

#: lazarusidestrconsts:lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Filtern, wenn der Methodenstart paßt"

#: lazarusidestrconsts:srvk_final
msgid "Final"
msgstr "Zárás"

#: lazarusidestrconsts:lismenufind
msgid "Find"
msgstr "Keresés"

#: lazarusidestrconsts:lismenufindnext
msgid "Find &Next"
msgstr "Következő kere&sése"

#: lazarusidestrconsts:lismenufindprevious
msgid "Find &Previous"
msgstr "El&őző keresése"

#: lazarusidestrconsts:lismenufindinfiles
msgid "Find &in files ..."
msgstr "Keresés &Fájlokban ..."

#: lazarusidestrconsts:lismenufind2
msgid "Find ..."
msgstr "Keresés ..."

#: lazarusidestrconsts:lismenufinddeclarationatcursor
msgid "Find Declaration at cursor"
msgstr "Kurzor alatti Deklaráció keresése"

#: lazarusidestrconsts:uemfindidentifierreferences
msgid "Find Identifier References"
msgstr "Azonosító hivatkozás keresése"

#: lazarusidestrconsts:lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Azonosító hivatkozás keresése ..."

#: lazarusidestrconsts:lismenutemplatefindnext
msgid "Find Next"
msgstr "Következő keresése"

#: lazarusidestrconsts:lisfrifindreferences
msgid "Find References"
msgstr "Referencia keresés"

#: lazarusidestrconsts:srkmecfindblockotherend
msgid "Find block other end"
msgstr "Blokk másik vég keresés"

#: lazarusidestrconsts:srkmecfindblockstart
msgid "Find block start"
msgstr "Blokk kezdet keresés"

#: lazarusidestrconsts:lismenufindcodeblockstart
msgid "Find code block start"
msgstr "Kód blokk kezdet keresés"

#: lazarusidestrconsts:liscomppalfindcomponent
msgid "Find component"
msgstr "Kompons keresése"

#: lazarusidestrconsts:srkmecfinddeclaration
msgid "Find declaration"
msgstr "Deklaráció keresése"

#: lazarusidestrconsts:srkmecfindidentifierrefs
msgid "Find identifier references"
msgstr " Azonosító hivatkozás keresése"

#: lazarusidestrconsts:srkmecfindinfiles
msgid "Find in files"
msgstr "Keresés Fájlban"

#: lazarusidestrconsts:liskmfindincremental
msgid "Find incremental"
msgstr "Változások keresése"

#: lazarusidestrconsts:srkmecfindnext
msgid "Find next"
msgstr "Következő keresése"

#: lazarusidestrconsts:srkmecfindnextwordoccurrence
msgid "Find next word occurrence"
msgstr "Kifejezés következő előfordulásának keresése"

#: lazarusidestrconsts:lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Azonosító keresése vagy átnevezése"

#: lazarusidestrconsts:lismenufindblockotherendofcodeblock
msgid "Find other end of code block"
msgstr "Kód blokk vége keresés"

#: lazarusidestrconsts:lisfpfindpalettecomponent
msgid "Find palette component"
msgstr "Palettán lévő komponens keresése"

#: lazarusidestrconsts:srkmecfindprevious
msgid "Find previous"
msgstr "Előző keresése"

#: lazarusidestrconsts:srkmecfindprevwordoccurrence
msgid "Find previous word occurrence"
msgstr "Kifejezés előző előfordulásának keresése"

#: lazarusidestrconsts:srkmecfindproceduredefinition
msgid "Find procedure definiton"
msgstr "Eljárás definíció keresése"

#: lazarusidestrconsts:srkmecfindproceduremethod
msgid "Find procedure method"
msgstr "Procedura metódus keresése"

#: lazarusidestrconsts:srkmecfind
msgid "Find text"
msgstr "Szöveg keresés"

#: lazarusidestrconsts:dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Szöveg keresése kurzornál"

#: lazarusidestrconsts:rslanguagefinnish
msgid "Finnish"
msgstr "Finn"

#: lazarusidestrconsts:lisfixlfmfile
msgid "Fix LFM file"
msgstr ".LFM Fájl kijavítás"

#: lazarusidestrconsts:srkmecjumptoeditor
msgid "Focus to source editor"
msgstr "Fókusz a Forráskód szerkesztőre"

#: lazarusidestrconsts:liscefollowcursor
msgid "Follow cursor"
msgstr "Kurzor követés"

#: lazarusidestrconsts:lisuefontwith
msgid "Font without UTF-8"
msgstr "Betűtípus UTF 8 nélkül"

#: lazarusidestrconsts:lisforcerenaming
msgid "Force renaming"
msgstr "Átnevezés rákényszerítése"

#: lazarusidestrconsts:dlgforecolor
msgid "Foreground color"
msgstr "Betű szín"

#: lazarusidestrconsts:dlgfrmeditor
msgid "Form Editor"
msgstr "Form szerkesztő"

#: lazarusidestrconsts:rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr "Form adat Fájl (*.dfm)|*.dfm"

#: lazarusidestrconsts:lisformloaderror
msgid "Form load error"
msgstr "Form betöltési hiba"

#: lazarusidestrconsts:lisformaterror
msgid "Format error"
msgstr "Formai hiba"

#: lazarusidestrconsts:dlgpofroms
msgid "Forms"
msgstr "Formok"

#: lazarusidestrconsts:lismenuviewforms
msgid "Forms..."
msgstr "Formok ..."

#: lazarusidestrconsts:fdmorderforwardone
msgid "Forward one"
msgstr "Egyel előre"

#: lazarusidestrconsts:lisfrforwardsearch
msgid "Forward search"
msgstr "Tovább keresés"

#: lazarusidestrconsts:lisfreepascalcompilernotfound
msgid "Free Pascal Compiler not found"
msgstr "Free Pascal fordító nincs meg"

#: lazarusidestrconsts:lisfreepascalsourcesnotfound
msgid "Free Pascal Sources not found"
msgstr "Free Pascal forráskód nincs meg"

#: lazarusidestrconsts:lisfreepascalsourcefile
msgid "FreePascal source file"
msgstr "Free Pascal forrás fájl"

#: lazarusidestrconsts:lisfreepascalsourcedirectory
msgid "Freepascal source directory"
msgstr "Free Pascal forráskód könyvtár"

#: lazarusidestrconsts:rslanguagefrench
msgid "French"
msgstr "Francia"

#: lazarusidestrconsts:dlgfromcursor
msgid "From Cursor"
msgstr "Kurzortól"

#: lazarusidestrconsts:listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Funkció: Útvonalhatároló hozzáfűzése"

#: lazarusidestrconsts:listmfunctionchomppathdelimiter
msgid "Function: chomp path delimiter"
msgstr "Funktion: Pfadseparator entfernen"

#: lazarusidestrconsts:listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Funktion: Fájlkiterjesztés kiemelése"

#: lazarusidestrconsts:listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Funktion: Fájlnév kiemelése"

#: lazarusidestrconsts:listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Funktion: Fájlnév+kiterjesztés kiemelése"

#: lazarusidestrconsts:listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Funktion: Fájlútvonal kiemelése"

#: lazarusidestrconsts:dlggpccomp
msgid "GPC (GNU Pascal Compiler) Compatible"
msgstr "GPC (GNU Pascal Fordító) kompatibilis"

#: lazarusidestrconsts:lismenuinsertgplnotice
msgid "GPL notice"
msgstr "GPL megjegyzés"

#: lazarusidestrconsts:lismenuinsertgeneral
msgid "General"
msgstr "Általános"

#: lazarusidestrconsts:lispckeditgeneraloptions
msgid "General Options"
msgstr "Általános beállítások"

#: lazarusidestrconsts:srkmecenvironmentoptions
msgid "General environment options"
msgstr "Általános fejlesztőkörnyezet beállítások"

#: lazarusidestrconsts:dlgcodbx
msgid "Generate Debugging Info For DBX (Slows Compiling)"
msgstr "DebugInfo generálás DBX számára (Lassú fordítás)"

#: lazarusidestrconsts:dlgcogdb
msgid "Generate Debugging Info For GDB (Slows Compiling)"
msgstr "DebugInfo generálás GDB számára (Lassú fordítás)"

#: lazarusidestrconsts:dlggprof
msgid "Generate code for gprof"
msgstr "Kódgenerálás gprof számára"

#: lazarusidestrconsts:dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Code für valgrind Létrehozás"

#: lazarusidestrconsts:dlgcogenerate
msgid "Generate:"
msgstr "Generálás:"

#: lazarusidestrconsts:rslanguagegerman
msgid "German"
msgstr "Német"

#: lazarusidestrconsts:dlggetposition
msgid "Get position"
msgstr "Jelenlegi Pozíció"

#: lazarusidestrconsts:dlgglobal
msgid "Global"
msgstr "Globális"

#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition
msgid "Global Source Path addition"
msgstr "Forrás útvonal hozzáadása"

#: lazarusidestrconsts:srkmecgotomarker
msgid "Go to Marker %d"
msgstr "Menj könyvjelzőhöz %d"

#: lazarusidestrconsts:srkmecgotoeditor
msgid "Go to editor %d"
msgstr "Menj szerkesztőhöz %d"

#: lazarusidestrconsts:srkmecgotolinenumber
msgid "Go to line number"
msgstr "Menj sorszámra"

#: lazarusidestrconsts:liskmgotomarker0
msgid "Go to marker 0"
msgstr "Zur 0. Markierung gehen"

#: lazarusidestrconsts:liskmgotomarker1
msgid "Go to marker 1"
msgstr "Zur 1. Markierung gehen"

#: lazarusidestrconsts:liskmgotomarker2
msgid "Go to marker 2"
msgstr "Zur 2. Markierung gehen"

#: lazarusidestrconsts:liskmgotomarker3
msgid "Go to marker 3"
msgstr "Zur 3. Markierung gehen"

#: lazarusidestrconsts:liskmgotomarker4
msgid "Go to marker 4"
msgstr "Zur 4. Markierung gehen"

#: lazarusidestrconsts:liskmgotomarker5
msgid "Go to marker 5"
msgstr "Zur 5. Markierung gehen"

#: lazarusidestrconsts:liskmgotomarker6
msgid "Go to marker 6"
msgstr "Zur 6. Markierung gehen"

#: lazarusidestrconsts:liskmgotomarker7
msgid "Go to marker 7"
msgstr "Zur 7. Markierung gehen"

#: lazarusidestrconsts:liskmgotomarker8
msgid "Go to marker 8"
msgstr "Zur 8. Markierung gehen"

#: lazarusidestrconsts:liskmgotomarker9
msgid "Go to marker 9"
msgstr "Zur 9. Markierung gehen"

#: lazarusidestrconsts:srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Zur korrespondierenden Klammer springen"

#: lazarusidestrconsts:srkmecnexteditor
msgid "Go to next editor"
msgstr "Zu nächstem Editorfenster wechseln"

#: lazarusidestrconsts:srkmecpreveditor
msgid "Go to prior editor"
msgstr "Zu vorigem Editorfenster wechseln"

#: lazarusidestrconsts:liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Zum 1. Forráskódszerkesztő gehen"

#: lazarusidestrconsts:liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Zum 10. Forráskódszerkesztő gehen"

#: lazarusidestrconsts:liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Zum 2. Forráskódszerkesztő gehen"

#: lazarusidestrconsts:liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Zum 3. Forráskódszerkesztő gehen"

#: lazarusidestrconsts:liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Zum 4. Forráskódszerkesztő gehen"

#: lazarusidestrconsts:liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Zum 5. Forráskódszerkesztő gehen"

#: lazarusidestrconsts:liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Zum 6. Forráskódszerkesztő gehen"

#: lazarusidestrconsts:liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Zum 7. Forráskódszerkesztő gehen"

#: lazarusidestrconsts:liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Zum 8. Forráskódszerkesztő gehen"

#: lazarusidestrconsts:liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Zum 9. Forráskódszerkesztő gehen"

#: lazarusidestrconsts:srkmecgotoincludedirective
msgid "Go to to include directive of current include file"
msgstr "Zur Include-Anweisung der aktuellen Include-Fájl springen"

#: lazarusidestrconsts:listodogoto
msgid "Goto"
msgstr "Goto"

#: lazarusidestrconsts:srkmecgotoxy
msgid "Goto XY"
msgstr "Goto XY"

#: lazarusidestrconsts:lismenugotoincludedirective
msgid "Goto include directive"
msgstr "Ugrás Include direktívához"

#: lazarusidestrconsts:lismenugotoline
msgid "Goto line ..."
msgstr "Ugrás sorhoz ..."

#: lazarusidestrconsts:lisuegotoline
msgid "Goto line :"
msgstr "Ugrás sorra:"

#: lazarusidestrconsts:uemnextbookmark
msgid "Goto next Bookmark"
msgstr "Ugrás a következő könyvjelzőre"

#: lazarusidestrconsts:uemprevbookmark
msgid "Goto previous Bookmark"
msgstr "Ugrás az előző könyvjelzőre"

#: lazarusidestrconsts:listodolistgotoline
msgid "Goto selected source line"
msgstr "Ugrás a kijelölt forráskód sorra"

#: lazarusidestrconsts:srkmgrabkey
msgid "Grab key"
msgstr "Taste fangen"

#: lazarusidestrconsts:srkmgrabsecondkey
msgid "Grab second key"
msgstr "Zweite Taste fangen"

#: lazarusidestrconsts:dlggrabbercolor
msgid "Grabber color"
msgstr "Grabberfarbe"

#: lazarusidestrconsts:dlgenvgrid
msgid "Grid"
msgstr "Rács"

#: lazarusidestrconsts:dlggridcolor
msgid "Grid color"
msgstr "Rács szín"

#: lazarusidestrconsts:dlggridx
msgid "Grid size X"
msgstr "Rácsméret X"

#: lazarusidestrconsts:dlggridy
msgid "Grid size Y"
msgstr "Rácsméret Y"

#: lazarusidestrconsts:dlggroupundo
msgid "Group Undo"
msgstr "Csoport visszavonása"

#: lazarusidestrconsts:srkmecguessmisplacedifdef
msgid "Guess misplaced $IFDEF"
msgstr "Falsch gesetzte $IFDEF raten"

#: lazarusidestrconsts:lismenuguessmisplacedifdef
msgid "Guess misplaced IFDEF/ENDIF"
msgstr "Offene IFDEF/ENDIF erraten"

#: lazarusidestrconsts:lismenuguessunclosedblock
msgid "Guess unclosed block"
msgstr "Lezáratlan forráskód blokk"

#: lazarusidestrconsts:dlgenvlguidelines
msgid "Guide lines"
msgstr "Margó"

#: lazarusidestrconsts:dlgguttercolor
msgid "Gutter color"
msgstr "Farbe der Randleiste"

#: lazarusidestrconsts:dlggutterwidth
msgid "Gutter width"
msgstr "Randleistenbreite"

#: lazarusidestrconsts:dlghalfpagescroll
msgid "Half page scroll"
msgstr "Fél oldal görgetés"

#: lazarusidestrconsts:lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr "OnClick-Ereignis bedienen"

#: lazarusidestrconsts:lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Behandelt von"

#: lazarusidestrconsts:lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Vom Debugger behandelt"

#: lazarusidestrconsts:lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Vom Programm behandelt"

#: lazarusidestrconsts:srvk_hanja
msgid "Hanja"
msgstr "Hanja"

#: lazarusidestrconsts:lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr "Besitzt Register-Prozedur"

#: lazarusidestrconsts:lisheadercommentforclass
msgid "Header comment for class"
msgstr "Fejrész megjegyzés az osztálynak"

#: lazarusidestrconsts:dlgheapsize
msgid "Heap Size"
msgstr "Heap méret"

#: lazarusidestrconsts:rslanguagehebrew
msgid "Hebrew"
msgstr "Héber"

#: lazarusidestrconsts:dlgheightpos
msgid "Height:"
msgstr "Magasság:"

#: lazarusidestrconsts:srvk_help
msgid "Help"
msgstr "Súgó"

#: lazarusidestrconsts:lishlpoptshelpoptions
msgid "Help Options"
msgstr "Súgó beállítások"

#: lazarusidestrconsts:lishfmhelpforfreepascalcompilermessage
msgid "Help for FreePascal Compiler message"
msgstr "Súgó a FreePascal fordító üzenetekhez"

#: lazarusidestrconsts:srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Súgó menüparancsok"

#: lazarusidestrconsts:lishelpselectordialog
msgid "Help selector"
msgstr "Súgó választó"

#: lazarusidestrconsts:dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "IDE eltüntetése futtatáskor"

#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
msgstr "Anmerkung: Die Funktion \"Make Resourcestring\" erwartet eine Zeichenkettenkonstante.%s Bitte wählen Sie nur einen Zeichenkettenausdruck und verKeresésn Sie es noch einmal."

#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Anmerkung: Die Funktion \"Make Resourcestring\" erwartet eine Zeichenkettenkonstante.%s Bitte wählen Sie den Ausdruck und verKeresésn Sie es noch einmal."

#: lazarusidestrconsts:dlgedhintcommand
msgid "Hint: click on the command you want to edit"
msgstr "Anmerkung: Klicken Sie auf den Befehl, den Sie bearbeiten wollen"

#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgstr "Anmerkung: Sie setzen den Compilerpfad in Einstellungen->Umgebungseinstellungen->Fájlen->Compilerpfad"

#: lazarusidestrconsts:dlgpalhints
msgid "Hints for component palette"
msgstr "Buborékablak a komponens palettán"

#: lazarusidestrconsts:dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Buborékablak a gyorsgomboknál (Megnyitás, Mentés, ...)"

#: lazarusidestrconsts:srvk_home
msgid "Home"
msgstr "Kezdőpont"

#: lazarusidestrconsts:dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Pos1 springt zum nächsten Anfang"

#: lazarusidestrconsts:lishorizontal
msgid "Horizontal"
msgstr "Vízszintes"

#: lazarusidestrconsts:dlggridxhint
msgid "Horizontal grid step size"
msgstr "Vízszintes rácstávolság"

#: lazarusidestrconsts:dlghostapplication
msgid "Host application"
msgstr "Hostapplikation"

#: lazarusidestrconsts:uenotimplcapagain
msgid "I told You: Not implemented yet"
msgstr "Már mondtam: Ez nem működik"

#: lazarusidestrconsts:lisdebugoptionsfrmid
msgid "ID"
msgstr "ID"

#: lazarusidestrconsts:lispckoptsideintegration
msgid "IDE Integration"
msgstr "Beépítés az IDE-be"

#: lazarusidestrconsts:lisideoptions
msgid "IDE Options:"
msgstr "IDE beállítások"

#: lazarusidestrconsts:uepins
msgid "INS"
msgstr "Beilleszt"

#: lazarusidestrconsts:liscodetoolsoptsidentifier
msgid "Identifier"
msgstr "Azonosító"

#: lazarusidestrconsts:dlgedidcomlet
msgid "Identifier completion"
msgstr "Kód kiegészítés"

#: lazarusidestrconsts:lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Azonosító hossz:"

#: lazarusidestrconsts:dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Bezeichnerrichtlinie"

#: lazarusidestrconsts:lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Bezeichner-Präfix"

#: lazarusidestrconsts:lisfriidentifier
msgid "Identifier: %s"
msgstr "Azonosító: %s"

#: lazarusidestrconsts:liscodetoolsdefsif
msgid "If"
msgstr "If"

#: lazarusidestrconsts:uenotimpltext
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsifdef
msgid "IfDef"
msgstr "IfDef"

#: lazarusidestrconsts:liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"

#: lazarusidestrconsts:dlgignoreverb
msgid "Ignore"
msgstr "Mellőzés"

#: lazarusidestrconsts:lissortselignorespace
msgid "Ignore Space"
msgstr "Hely mellőzése"

#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "A space karakterek mellőzése"

#: lazarusidestrconsts:lispkgmangignoreandsavepackagenow
msgid "Ignore and save package now"
msgstr "Ignorieren und Package jetzt speichern"

#: lazarusidestrconsts:lisignorebinaries
msgid "Ignore binaries"
msgstr "Ignoriere BinärFájlen"

#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Ignoriere unterschiedliche Zeilenenden (z.B. #10 = #13#10)"

#: lazarusidestrconsts:lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "Ignoriere Änderungen auf dem Datenträger"

#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Ignorieren des Zufügens und Löschens leerer Zeilen"

#: lazarusidestrconsts:lisignoremissingfile
msgid "Ignore missing file"
msgstr "Hiányzó Fájl mellőzése"

#: lazarusidestrconsts:lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Leerzeichen übergehen (Zeilenumbruchzeichen nicht enthalten)"

#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Leerzeichen am Ende der Zeile übergehen"

#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Leerzeichen am Beginn der Zeile übergehen"

#: lazarusidestrconsts:lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Ezen kiterjesztések mellőzése"

#: lazarusidestrconsts:lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr "Übergehen, TForm als Vorfahr verwenden"

#: lazarusidestrconsts:srkmecimestr
msgid "Ime Str"
msgstr "Ime-String"

#: lazarusidestrconsts:lisimportlist
msgid "Import list"
msgstr "Import lista"

#: lazarusidestrconsts:dlginfrontofmethods
msgid "In front of methods"
msgstr "Vor Methoden"

#: lazarusidestrconsts:lispckoptsinclude
msgid "Include"
msgstr "Include"

#: lazarusidestrconsts:dlgassertcode
msgid "Include Assertion Code"
msgstr "Feltétel kódot tartalmaz"

#: lazarusidestrconsts:dlgcoincfiles
msgid "Include Files (-Fi):"
msgstr "Include Fájlok (-Fi):"

#: lazarusidestrconsts:lisincludefilter
msgid "Include Filter"
msgstr "Maske"

#: lazarusidestrconsts:lispkgfiletypeinclude
msgid "Include file"
msgstr "Include Fájl"

#: lazarusidestrconsts:lisincludepaths
msgid "Include paths"
msgstr "Include-Pfade"

#: lazarusidestrconsts:lisfindfileincludesubdirectories
msgid "Include sub directories"
msgstr "Alkönyvtárt tartalmaz"

#: lazarusidestrconsts:dlgincludesystemvariables
msgid "Include system variables"
msgstr "System Változó beillesztés"

#: lazarusidestrconsts:lisuidincludedby
msgid "Included by:"
msgstr "Eingebunden von:"

#: lazarusidestrconsts:lismenuincrementalfind
msgid "Incremental Find"
msgstr "Változások keresése"

#: lazarusidestrconsts:srkmecblockindent
msgid "Indent block"
msgstr "Blokk behúzás"

#: lazarusidestrconsts:dlgindentcodeto
msgid "Indent code to"
msgstr "Kód behúzás"

#: lazarusidestrconsts:lismenuindentselection
msgid "Indent selection"
msgstr "Kijelölt blokk behúzása"

#: lazarusidestrconsts:rslanguageindonesian
msgid "Indonesian"
msgstr "Indonéz"

#: lazarusidestrconsts:lisinformationaboutunit
msgid "Information about %s"
msgstr "Információ %s -ról"

#: lazarusidestrconsts:dlgcoinherited
msgid "Inherited"
msgstr "Öröklés"

#: lazarusidestrconsts:srvk_insert
msgid "Insert"
msgstr "Beillesztés"

#: lazarusidestrconsts:liskminsertifdef
msgid "Insert $IFDEF"
msgstr "$IFDEF beszúrása"

#: lazarusidestrconsts:lismenuconditionalselection
msgid "Insert $IFDEF..."
msgstr "$IFDEF beszúrása"

#: lazarusidestrconsts:srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "CVS Kulcsszó \"Szerző\" beillesztése"

#: lazarusidestrconsts:srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "CVS Kulcsszó \"Dátum\" beillesztése"

#: lazarusidestrconsts:srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "CVS kulcsszó Header beillesztése"

#: lazarusidestrconsts:srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "CVS kulcsszó ID beillesztése"

#: lazarusidestrconsts:srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "CVS-Schlüsselwort für das Log beillesztés"

#: lazarusidestrconsts:srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "CVS kulcsszó \"Név\" beillesztése"

#: lazarusidestrconsts:srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "CVS-Schlüsselwort für die Revision beillesztés"

#: lazarusidestrconsts:srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "CVS-Schlüsselwort für die Quelle beillesztés"

#: lazarusidestrconsts:srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "ChangeLog-Eintrag beillesztés"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Delphi-5-Compilervorlage beillesztés"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Delphi-5-Verzeichnisvorlage beillesztés"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Delphi-5-Projektvorlage beillesztés"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Delphi-6-Compilervorlage beillesztés"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Delphi-6-Verzeichnisvorlage beillesztés"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Delphi-6-Projektvorlage beillesztés"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Delphi-7-Compilervorlage beillesztés"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Delphi-7-Verzeichnisvorlage beillesztés"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Delphi-7-Projektvorlage beillesztés"

#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Free-Pascal-Compilervorlage beillesztés"

#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Free-Pascal-Projektvorlage beillesztés"

#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "Free-Pascal-SVN-Quellenverzeichnis beillesztés"

#: lazarusidestrconsts:lismenueditorinsertfromtemplate
msgid "Insert From Template..."
msgstr "Beillesztés mintából"

#: lazarusidestrconsts:srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "GPL-Megjegyzés beillesztés"

#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Kylix 3-Compilervorlage beillesztés"

#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Kylix-3-Verzeichnisvorlage beillesztés"

#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Kylix-3-Projektvorlage beillesztés"

#: lazarusidestrconsts:srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "LGPL-Megjegyzés beillesztés"

#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem
msgid "Insert Lazarus Directory Template"
msgstr "Lazarus-Verzeichnisvorlage beillesztés"

#: lazarusidestrconsts:lisctinsertmacro
msgid "Insert Macro"
msgstr "Makro beillesztés"

#: lazarusidestrconsts:srkmecinsertmode
msgid "Insert Mode"
msgstr "Einfügemodus"

#: lazarusidestrconsts:lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "Újn Eintrag beillesztés (dahinter)"

#: lazarusidestrconsts:lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "Újn Eintrag beillesztés (davor)"

#: lazarusidestrconsts:liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Kódminta beillesztés"

#: lazarusidestrconsts:lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Beillesztés Abc sorrendben"

#: lazarusidestrconsts:lislazdochintboldformat
msgid "Insert bold formatting tag"
msgstr "Formatzeichen für Fettschrift beillesztés"

#: lazarusidestrconsts:lislazdochintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Formatzeichen für Code beillesztés"

#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Kontextsensitiv beszúrása"

#: lazarusidestrconsts:srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Dátum és időpont beszúrása"

#: lazarusidestrconsts:srkmecinsertusername
msgid "Insert current username"
msgstr "Aktuális felhasználónév beszúrása"

#: lazarusidestrconsts:liskminsertdateandtime
msgid "Insert date and time"
msgstr "Dátum és időpont beszúrása"

#: lazarusidestrconsts:lismenuinsertcharacter
msgid "Insert from Character Map"
msgstr "Karakter tábla..."

#: lazarusidestrconsts:srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Karakter tábla"

#: lazarusidestrconsts:lislazdochintitalicformat
msgid "Insert italic formatting tag"
msgstr "Dőlt betű beszúrása"

#: lazarusidestrconsts:srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Megjegyzés zur modifizierten LGPL beillesztés"

#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Csomópont beszúrása utódként"

#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Beszúrás csomópont alá"

#: lazarusidestrconsts:lislazdochintremarktag
msgid "Insert remark formatting tag"
msgstr "Megjegyzés beszúrása"

#: lazarusidestrconsts:dlginsspaceafter
msgid "Insert space after"
msgstr "Beszúrás szóköz után"

#: lazarusidestrconsts:dlginsspacefront
msgid "Insert space in front of"
msgstr "Beszúrás szóköz elé"

#: lazarusidestrconsts:lismenuinserttext
msgid "Insert text"
msgstr "Szöveg beszúrása"

#: lazarusidestrconsts:lislazdochintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Aláhúzott beszúrása"

#: lazarusidestrconsts:liskminsertusername
msgid "Insert username"
msgstr "Felhasználónév beszúrása"

#: lazarusidestrconsts:lislazdochintvartag
msgid "Insert var formatting tag"
msgstr "Formatzeichen für Var beillesztés"

#: lazarusidestrconsts:liskminspect
msgid "Inspect"
msgstr "Megvizsgál"

#: lazarusidestrconsts:lismenuinspect
msgid "Inspect ..."
msgstr "Megvizsgál ..."

#: lazarusidestrconsts:lispckeditinstall
msgid "Install"
msgstr "Telepítés"

#: lazarusidestrconsts:lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Telepítse a következő indításkor"

#: lazarusidestrconsts:lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "Installiere Packages in der IDE"

#: lazarusidestrconsts:lisinstallselection
msgid "Install selection"
msgstr "Kijelölt telepítése"

#: lazarusidestrconsts:lisinstallationfailed
msgid "Installation failed"
msgstr "Telepítési hiba"

#: lazarusidestrconsts:lispckexplinstalled
msgid "Installed"
msgstr "Installálva"

#: lazarusidestrconsts:lisinstalledpackages
msgid "Installed Packages"
msgstr "Installált csomagok"

#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr "Die Installation des Packages %s installiert automatisch das Package:"

#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "Die Installation des Packages %s installiert automatisch die Packages:"

#: lazarusidestrconsts:lisdebugoptionsfrminterface
msgid "Interface"
msgstr "Interface"

#: lazarusidestrconsts:listcompilerinternalerror
msgid "Internal compiler error! (%d)"
msgstr "Interner Compilerfehler! (%d)"

#: lazarusidestrconsts:dlgintvinsec
msgid "Interval in secs"
msgstr "Intervall in Sekunden"

#: lazarusidestrconsts:lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Ungültiger Basisklasse"

#: lazarusidestrconsts:lisa2pinvalidcircle
msgid "Invalid Circle"
msgstr "Ungültiger Kreis"

#: lazarusidestrconsts:lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Érvénytelen osztálynév"

#: lazarusidestrconsts:lisinvalidcompilerfilename
msgid "Invalid Compiler Filename"
msgstr "Érvénytelen fordító fájlnév"

#: lazarusidestrconsts:lispublprojinvalidexcludefilter
msgid "Invalid Exclude filter"
msgstr "Ungültiger Ausschlußfilter"

#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory
msgid "Invalid Free Pascal source directory"
msgstr "Ungültiges Free-Pascal-Quelltextverzeichnis"

#: lazarusidestrconsts:lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Érvénytelen azonosító"

#: lazarusidestrconsts:lispublprojinvalidincludefilter
msgid "Invalid Include filter"
msgstr "Ungültiger Include-Filter"

#: lazarusidestrconsts:lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Érvénytelen Min-Max Verzió"

#: lazarusidestrconsts:lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Érvénytelen csomag"

#: lazarusidestrconsts:lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Érvénytelen csomagnév"

#: lazarusidestrconsts:lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Érvénytelen Pascal Azonosító"

#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Érvénytelen Erőforrás szekció "

#: lazarusidestrconsts:lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Érvénytelen Unit név"

#: lazarusidestrconsts:lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "Érvénytelen Unit név: %s"

#: lazarusidestrconsts:lisinvalidcommand
msgid "Invalid command"
msgstr "Érvénytelen parancs"

#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename
msgid "Invalid compiler filename"
msgstr "Ungültiger CompilerFájlname"

#: lazarusidestrconsts:lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Érvénytelen komponensosztály"

#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Érvénytelen hibakereső fájlnév"

#: lazarusidestrconsts:lisinvaliddelete
msgid "Invalid delete"
msgstr "Ungültiger Löschvorgang"

#: lazarusidestrconsts:lisinvaliddestinationdirectory
msgid "Invalid destination directory"
msgstr "Érvénytelen célkönyvtár"

#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Ungültiger Ausdruck.%sMegjegyzés: Die Ressourcenstring-Funktion Make erwartet eine Zeichenkettenkonstante in einer einzelnen Fájl. Bitte wählen Sie den Ausdruck und verKeresésn Sie es noch einmal."

#: lazarusidestrconsts:lisa2pinvalidfile
msgid "Invalid file"
msgstr "Érvénytelen fájl"

#: lazarusidestrconsts:lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Érvénytelen fájlkiterjesztés"

#: lazarusidestrconsts:lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Érvénytelen fájlnév"

#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename
msgid "Invalid make filename"
msgstr "Ungültiger Make-Fájlname"

#: lazarusidestrconsts:lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Ungültige Maximalversion"

#: lazarusidestrconsts:lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Ungültige Minimalvesion"

#: lazarusidestrconsts:lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Ungültige MehrfachKijelölt"

#: lazarusidestrconsts:liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr "Ungültige Option an der Position %d: \"%s\""

#: lazarusidestrconsts:lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr "Ungültige Csomag ID: %s%s%s"

#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Ungültige Csomag Fájlendung"

#: lazarusidestrconsts:lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Ungültiger Csomag Fájlname"

#: lazarusidestrconsts:lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Ungültiger Csomag Name"

#: lazarusidestrconsts:lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Ungültiger Csomag Typ"

#: lazarusidestrconsts:lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr "Ungültiger Csomag Name"

#: lazarusidestrconsts:liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Ungültiger Vorfahr"

#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Ungültiger Elternknoten"

#: lazarusidestrconsts:lisprojaddinvalidpascalunitname
msgid "Invalid pascal unit name"
msgstr "Ungültiger PascalFájlname"

#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Ungültiger Vorgängerknoten"

#: lazarusidestrconsts:lisinvalidprocname
msgid "Invalid proc name"
msgstr "Ungültiger Proc-Name"

#: lazarusidestrconsts:lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Ungültiger ProjektFájlname"

#: lazarusidestrconsts:lisinvalidselection
msgid "Invalid selection"
msgstr "Ungültige Kijelölt"

#: lazarusidestrconsts:lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Ungültiger UnitFájlname"

#: lazarusidestrconsts:lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Ungültiger Unitname"

#: lazarusidestrconsts:lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Ungültiger Változónname"

#: lazarusidestrconsts:lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Ungültige Version"

#: lazarusidestrconsts:ueminvertassignment
msgid "Invert Assignment"
msgstr "Umgekehrte Zuweisung"

#: lazarusidestrconsts:srkmecinvertassignment
msgid "Invert assignment"
msgstr "Umgekehrte Zuweisung"

#: lazarusidestrconsts:srvk_irregular
msgid "Irregular "
msgstr "Irregulär"

#: lazarusidestrconsts:rslanguageitalian
msgid "Italian"
msgstr "Olasz"

#: lazarusidestrconsts:dlgedital
msgid "Italic"
msgstr "Dőlt"

#: lazarusidestrconsts:dlgoiitemheight
msgid "Item height"
msgstr "Sormagasság"

#: lazarusidestrconsts:rslanguagejapanese
msgid "Japanese"
msgstr "Japán"

#: lazarusidestrconsts:lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Kijelöléshez ugrás"

#: lazarusidestrconsts:lismenujumpback
msgid "Jump back"
msgstr "Ugrás vissza"

#: lazarusidestrconsts:lismenujumpforward
msgid "Jump forward"
msgstr "Ugrás előre"

#: lazarusidestrconsts:lismenujumpto
msgid "Jump to"
msgstr "Ugrás sorhoz"

#: lazarusidestrconsts:lismenujumptonextbookmark
msgid "Jump to next bookmark"
msgstr "Ugrás a következő könyvjelzőre"

#: lazarusidestrconsts:lismenujumptonexterror
msgid "Jump to next error"
msgstr "Ugrás a következő hibára"

#: lazarusidestrconsts:lismenujumptoprevbookmark
msgid "Jump to previous bookmark"
msgstr "Ugrás az előző könyvjelzőre"

#: lazarusidestrconsts:lismenujumptopreverror
msgid "Jump to previous error"
msgstr "Ugrás az előző hibára"

#: lazarusidestrconsts:dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Ugrás (bspw. Methodenspringen)"

#: lazarusidestrconsts:srvk_junja
msgid "Junja"
msgstr "Junja"

#: lazarusidestrconsts:srvk_kana
msgid "Kana"
msgstr "Kana"

#: lazarusidestrconsts:liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Minden text fájl megőrzése"

#: lazarusidestrconsts:dlgkeepcaretx
msgid "Keep caret X position"
msgstr "Kurzor X pozíciójának megtartása"

#: lazarusidestrconsts:dlgcokeepvarsreg
msgid "Keep certain variables in registers"
msgstr "Bizonyos változók megtartása a regiszterekben"

#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Mit Filter übereinstimmende Fájlen behalten"

#: lazarusidestrconsts:liskeepname
msgid "Keep name"
msgstr "Név megtartása"

#: lazarusidestrconsts:dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Procedúrák sorrendjének megtartása"

#: lazarusidestrconsts:liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Megtartás és folytatás"

#: lazarusidestrconsts:lisedtexttoolkey
msgid "Key"
msgstr "Billentyű"

#: lazarusidestrconsts:srkmkey
msgid "Key (or 2 keys combination)"
msgstr "Billentyű (vagy 2 billentyű kombinációja)"

#: lazarusidestrconsts:dlgkeymappingscheme
msgid "Key Mapping Scheme"
msgstr "Billentyű térkép terv"

#: lazarusidestrconsts:dlgkeymapping
msgid "Key Mappings"
msgstr "Billentyű térkép"

#: lazarusidestrconsts:dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Billentyűtérkép hiba"

#: lazarusidestrconsts:liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Billentyű térkép terv"

#: lazarusidestrconsts:liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Kulcsszó"

#: lazarusidestrconsts:dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Schlüsselwortrichtlinie"

#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "LCL Interfész specifikus beállítások:"

#: lazarusidestrconsts:lislclwidgettype
msgid "LCL Widget Type"
msgstr "LCL céleszköz típus"

#: lazarusidestrconsts:lislazbuildlclinterface
msgid "LCL interface"
msgstr "LCL interfész"

#: lazarusidestrconsts:lislclunitpathmissing
msgid "LCL unit path missing"
msgstr "LCL elérési út hiányzik"

#: lazarusidestrconsts:lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "LFM - Lazarus-Formtext"

#: lazarusidestrconsts:lislfmfile
msgid "LFM file"
msgstr "LFM-Fájl"

#: lazarusidestrconsts:lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "LFM fájl hibás"

#: lazarusidestrconsts:lislfmfilenotfound
msgid "LFM file not found"
msgstr "LFM fájl nincs meg"

#: lazarusidestrconsts:lismenuinsertlgplnotice
msgid "LGPL notice"
msgstr "LGPL Megjegyzés"

#: lazarusidestrconsts:lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "LRS - Lazarus erőforrás"

#: lazarusidestrconsts:dlgenvlanguage
msgid "Language"
msgstr "Nyelv"

#: lazarusidestrconsts:lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Nyelvi kivételek"

#: lazarusidestrconsts:dlgcdtlast
msgid "Last"
msgstr "Végére"

#: lazarusidestrconsts:dlglast
msgid "Last (i.e. at end of source)"
msgstr "Letzter (d.h. am Ende des Quelltexts)"

#: lazarusidestrconsts:lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Indító program"

#: lazarusidestrconsts:lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Indító program érvénytelen"

#: lazarusidestrconsts:lislaunchingcmdline
msgid "Launching target command line"
msgstr "Projekt indító parancssor"

#: lazarusidestrconsts:lislazdoc
msgid "LazDoc"
msgstr "LazDoc"

#: lazarusidestrconsts:lismenulazdoc
msgid "LazDoc Editor"
msgstr "LazDoc szerkesztő"

#: lazarusidestrconsts:lislazdocmainformcaption
msgid "LazDoc editor"
msgstr "LazDoc szerkesztő"

#: lazarusidestrconsts:lislazdocpathsgroupbox
msgid "LazDoc settings"
msgstr "LazDoc beállítások"

#: lazarusidestrconsts:lispkgmanglazarus
msgid "Lazarus"
msgstr "Lazarus"

#: lazarusidestrconsts:lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr "Lazarus Asztal Beállítások"

#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory
msgid "Lazarus Directory"
msgstr "Lazarus könyvtár"

#: lazarusidestrconsts:lislazaruseditorv
msgid "Lazarus Editor v%s"
msgstr "Lazarus Fejlesztő környezet v%s"

#: lazarusidestrconsts:lislazarusfile
msgid "Lazarus File"
msgstr "Lazarus Fájl"

#: lazarusidestrconsts:lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr "Lazarus Projekt info fájl"

#: lazarusidestrconsts:locwndsrceditor
msgid "Lazarus Source Editor"
msgstr "Lazarus-Forráskódszerkesztő"

#: lazarusidestrconsts:lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Lazarus konfigurációs könyvtár"

#: lazarusidestrconsts:lislazarusdirectory
msgid "Lazarus directory"
msgstr "Lazarus könyvtár"

#: lazarusidestrconsts:dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Lazarus könyvtár (Minden Projektnek alapértelmezett)"

#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg
msgid "Lazarus directory \"%s\" not found."
msgstr "Lazarus könyvtár \"%s\" nincs meg."

#: lazarusidestrconsts:lislazarusdirectorynotfound
msgid "Lazarus directory not found"
msgstr "Lazarus könyvtár nincs meg"

#: lazarusidestrconsts:lislazarusform
msgid "Lazarus form"
msgstr "Lazarus Form"

#: lazarusidestrconsts:lislazarusinclude
msgid "Lazarus include file"
msgstr "Lazarus Include Fájl"

#: lazarusidestrconsts:lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "Lazarus nyelv ID (Pl.: en, de, br, fi)"

#: lazarusidestrconsts:lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Lazarus nyelv (Pl.: Angol, Német)"

#: lazarusidestrconsts:lislazaruspackage
msgid "Lazarus package"
msgstr "Lazarus csomag"

#: lazarusidestrconsts:lislazarusproject
msgid "Lazarus project"
msgstr "Lazarus Projekt"

#: lazarusidestrconsts:lislazarusprojectsource
msgid "Lazarus project source"
msgstr "Lazarus Projekt forráskód"

#: lazarusidestrconsts:lislazarusunit
msgid "Lazarus unit"
msgstr "Lazarus Unit"

#: lazarusidestrconsts:lisleaveemptyfo
msgid "Leave empty for default .po file"
msgstr "Hagyd üresen az alap .po fájlt"

#: lazarusidestrconsts:srvk_left
msgid "Left"
msgstr "Bal"

#: lazarusidestrconsts:lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Bal Horgony"

#: lazarusidestrconsts:lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Linker Randabstand. Der Wert wird zum Grund-Randabstand addiert und für den Platz links vom Element verwendet."

#: lazarusidestrconsts:lisleftsides
msgid "Left sides"
msgstr "Bal oldal"

#: lazarusidestrconsts:lisleftspaceequally
msgid "Left space equally"
msgstr "Bal oldali térköz egyenlő"

#: lazarusidestrconsts:dlgleftpos
msgid "Left:"
msgstr "Bal:"

#: lazarusidestrconsts:dlglevelnoneopt
msgid "Level 0 (no extra Optimizations)"
msgstr "Szint 0 (nincs Optimalizáció)"

#: lazarusidestrconsts:dlglevel1opt
msgid "Level 1 (Quick Optimizations)"
msgstr "Szint 1 (Gyors Optimalizáció)"

#: lazarusidestrconsts:dlglevel2opt
msgid "Level 2 (Level 1 + Slower Optimizations)"
msgstr "Szint 2 (Szint 1 + Lassú Optimalizáció)"

#: lazarusidestrconsts:dlglevel3opt
msgid "Level 3 (Level 2 + Uncertain)"
msgstr "Szint 3 (Szint 2 + Nem megbízható Optimalizáció)"

#: lazarusidestrconsts:dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Könyvtárak (-Fl):"

#: lazarusidestrconsts:lispckoptslibrary
msgid "Library"
msgstr "Könyvtár"

#: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin
msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
msgstr "Könyvtár%sEgy Free Pascal Könyvtár (.dll Windows alatt, .so Linux/BSD, .dylib MacOS X-en). A könyvtár forrásfájlját automatikusan a Lazarus támogatja"

#: lazarusidestrconsts:lispckoptslicense
msgid "License:"
msgstr "Liszensz:"

#: lazarusidestrconsts:lisaboutlazarusmsg
msgid "License: GPL/LGPL%sLazarus are the class libraries for Free Pascal that emulate Delphi. Free Pascal is a (L)GPL'ed compiler that runs on Linux, Win32, OS/2, 68K and more. Free Pascal is designed to be able to understand and compile Delphi syntax, which is of course OOP.%sLazarus is the missing part of the puzzle that will allow you to develop Delphi like programs in all of the above platforms. The IDE will eventually become a RAD tool like Delphi.%sAs Lazarus is growing we need more developers."
msgstr "Lizenz: GPL/LGPL%sLazarus ist der Name einer Sammlung von Klassenbibliotheken für Free Pascal die Delphi emulieren. Free Pascal ist ein Compiler unter (L)GPL, der unter Linux, Win32, FreeBSD, MacOS X und so weiter läuft. Free Pascal wurde entworfen, um die Delphi-Syntax, die natürlich objektorientiert ist, zu verstehen und zu kompilieren.%sLazarus ist das fehlende Teil des Puzzles, um Delphi-artige Programme auf den oben angeführten Plattformen entwickeln zu können. Die IDE wird vielleicht ein RAD-Tool wie Delphi werden%sDamit Lazarus weiter wächst, benötigen wir ständig Új Entwickler."

#: lazarusidestrconsts:lisdebugoptionsfrmlimitlinecountto
msgid "Limit linecount to"
msgstr "Sorszám korlátozás"

#: lazarusidestrconsts:listodolline
msgid "Line"
msgstr "Sor"

#: lazarusidestrconsts:dlglinesplitting
msgid "Line Splitting"
msgstr "Sor felosztás"

#: lazarusidestrconsts:srkmeclineselect
msgid "Line selection mode"
msgstr "Sor kijelölés módja"

#: lazarusidestrconsts:lissortsellines
msgid "Lines"
msgstr "Sorok"

#: lazarusidestrconsts:lisuidlines
msgid "Lines:"
msgstr "Sorok:"

#: lazarusidestrconsts:dlglinksmart
msgid "Link Smart"
msgstr "Okos Linkelés"

#: lazarusidestrconsts:dlglinklibraries
msgid "Link Style:"
msgstr "Linkelési Stílus:"

#: lazarusidestrconsts:lispckoptslinker
msgid "Linker"
msgstr "Linker"

#: lazarusidestrconsts:dlgcolinking
msgid "Linking"
msgstr "Linkelés"

#: lazarusidestrconsts:dlgloaddfile
msgid "Load desktop settings from file"
msgstr "Asztalbeállítás betöltése Fájlból"

#: lazarusidestrconsts:lisiecoloadfromfile
msgid "Load from file"
msgstr "Betöltés Fájlból"

#: lazarusidestrconsts:dlgcoloadsave
msgid "Load/Save"
msgstr "Betöltés/Mentés"

#: lazarusidestrconsts:lispckexplloadedpackages
msgid "Loaded Packages:"
msgstr "Betöltött csomagok:"

#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr "Das Laden des Packages %s wird das Package %s%saus der Fájl %s ersetzen.%sDas alte Package wurde geändert.%s%sAltes Package %s speichern?"

#: lazarusidestrconsts:dlgrunolocal
msgid "Local"
msgstr "Helyi"

#: lazarusidestrconsts:lismenuviewlocalvariables
msgid "Local Variables"
msgstr "Helyi Változók"

#: lazarusidestrconsts:lismenulowercaseselection
msgid "Lowercase selection"
msgstr "Kijelölt - kisbetűk"

#: lazarusidestrconsts:dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Kisbetű, első betű nagy"

#: lazarusidestrconsts:lisedtexttoolmacros
msgid "Macros"
msgstr "Makrók"

#: lazarusidestrconsts:dlgmainmenu
msgid "Main Menu"
msgstr "Fő menü"

#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements
msgid "Main Unit has Application.CreateForm statements"
msgstr "A fő Unit egy Alkalmazás. \"Application.CreateForm\"."

#: lazarusidestrconsts:lismainunithasapplicationtitlestatements
msgid "Main Unit has Application.Title statements"
msgstr "Die Hauptunit enthält die Anweisung \"Application.Title\"."

#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject
msgid "Main Unit has Uses Section containing all Units of project"
msgstr "Die Hauptunit enthält einen Uses-Abschnitt mit allen Units des Projekt"

#: lazarusidestrconsts:lismainunitispascalsource
msgid "Main Unit is Pascal Source"
msgstr "A fő Unit Pascal forráskód."

#: lazarusidestrconsts:lispckoptsmajor
msgid "Major"
msgstr "Major"

#: lazarusidestrconsts:lismakeexe
msgid "Make Executable"
msgstr "Készítsen futtatható Fájlt"

#: lazarusidestrconsts:lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Erőforrás string készítés ..."

#: lazarusidestrconsts:lismakeresourcestring
msgid "Make ResourceString"
msgstr "Erőforrás string készítés"

#: lazarusidestrconsts:lismakenotfound
msgid "Make not found"
msgstr "Make nincs meg"

#: lazarusidestrconsts:dlgmakepath
msgid "Make path"
msgstr "Make-Verzeichnis"

#: lazarusidestrconsts:srkmecmakeresourcestring
msgid "Make resource string"
msgstr "Erőforrás string készítés"

#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Kézi fordítás (soha nem automatikus)"

#: lazarusidestrconsts:dlgmargingutter
msgid "Margin and gutter"
msgstr "Margó és elválasztó"

#: lazarusidestrconsts:dlgmarkercolor
msgid "Marker color"
msgstr "Jelzőszín"

#: lazarusidestrconsts:lissmatches
msgid "Matches"
msgstr "Illesztés"

#: lazarusidestrconsts:dlgmaxlinelength
msgid "Max line length:"
msgstr "Maximum sor hossz:"

#: lazarusidestrconsts:dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Maximum létrehozható Fájl"

#: lazarusidestrconsts:dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Maximum létrehozható Projekt Fájl"

#: lazarusidestrconsts:lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached "
msgstr "Maximale Zahl von Werkzeugen erreicht"

#: lazarusidestrconsts:lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Legmagasabb Verzió (opciós):"

#: lazarusidestrconsts:lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Legmagasabb Verzió:"

#: lazarusidestrconsts:dlgmaxcntr
msgid "Maximum counter"
msgstr "Számláló maximum"

#: lazarusidestrconsts:srvk_menu
msgid "Menu"
msgstr "Menü"

#: lazarusidestrconsts:lismenueditormenueditor
msgid "Menu Editor"
msgstr "Menüszerkesztő"

#: lazarusidestrconsts:lismenuviewmessages
msgid "Messages"
msgstr "Üzenetek"

#: lazarusidestrconsts:dlgmethodinspolicy
msgid "Method insert policy"
msgstr "Verhalten für das beillesztés von Methoden"

#: lazarusidestrconsts:dlgminimizeallonminimizemain
msgid "Minimize all on minimize main"
msgstr "Minden minimalizálása, ha a fő Form minimize"

#: lazarusidestrconsts:lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Legalacsonyabb Verzió (opciós):"

#: lazarusidestrconsts:lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Legalacsonyabb Verzió:"

#: lazarusidestrconsts:lispckoptsminor
msgid "Minor"
msgstr "Minor"

#: lazarusidestrconsts:fdmmirrorhorizontal
msgid "Mirror horizontal"
msgstr "Vízszintes tükrözés"

#: lazarusidestrconsts:fdmmirrorvertical
msgid "Mirror vertical"
msgstr "Függőleges tükrözés"

#: lazarusidestrconsts:dlgenvmisc
msgid "Miscellaneous"
msgstr "Vegyes"

#: lazarusidestrconsts:lismissingevents
msgid "Missing Events"
msgstr "Hiányzó esemény"

#: lazarusidestrconsts:lismissingpackages
msgid "Missing Packages"
msgstr "Hiányzó csomag"

#: lazarusidestrconsts:dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Metódusok és tulajdonságok keverve"

#: lazarusidestrconsts:srvk_modechange
msgid "Mode Change"
msgstr "Üzemmód váltás"

#: lazarusidestrconsts:uemodified
msgid "Modified"
msgstr "Módosított"

#: lazarusidestrconsts:lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL notice"
msgstr "Módosított LGPL Liszensz"

#: lazarusidestrconsts:lispckeditmodified
msgid "Modified: %s"
msgstr "Módosított: %s"

#: lazarusidestrconsts:lisdebugoptionsfrmmodule
msgid "Module"
msgstr "Modul"

#: lazarusidestrconsts:lispckeditmore
msgid "More ..."
msgstr "Több ..."

#: lazarusidestrconsts:srvk_lbutton
msgid "Mouse Button Left"
msgstr "Bal egérgomb"

#: lazarusidestrconsts:srvk_mbutton
msgid "Mouse Button Middle"
msgstr "Középső egérgomb"

#: lazarusidestrconsts:srvk_rbutton
msgid "Mouse Button Right"
msgstr "Jobb egérgomb"

#: lazarusidestrconsts:dlgmouselinks
msgid "Mouse links"
msgstr "Egér kezelőgomb"

#: lazarusidestrconsts:lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Mozgat lefelé (vagy jobbra)"

#: lazarusidestrconsts:uemmoveeditorleft
msgid "Move Editor Left"
msgstr "Lapot egyel balra"

#: lazarusidestrconsts:uemmoveeditorright
msgid "Move Editor Right"
msgstr "Lapot egyel jobbra"

#: lazarusidestrconsts:lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Mozgat felfelé (vagy balra)"

#: lazarusidestrconsts:lisdsgorderbackone
msgid "Move component one back"
msgstr "Komponens egyel vissza"

#: lazarusidestrconsts:lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Komponens egyel előre"

#: lazarusidestrconsts:lisdsgordermovetoback
msgid "Move component to back"
msgstr "Komponens leghátra"

#: lazarusidestrconsts:lisdsgordermovetofront
msgid "Move component to front"
msgstr "Komponens legelőre"

#: lazarusidestrconsts:srkmecpagedown
msgid "Move cursor down one page"
msgstr "Bewege Cursor eine Seite nach unten"

#: lazarusidestrconsts:srkmecpageleft
msgid "Move cursor left one page"
msgstr "Bewege Cursor eine Seite nach links"

#: lazarusidestrconsts:srkmecpageright
msgid "Move cursor right one page"
msgstr "Bewege Cursor eine Seite nach rechts"

#: lazarusidestrconsts:srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Cursor an den absoluten Anfang bewegen"

#: lazarusidestrconsts:srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Kurzor a végére"

#: lazarusidestrconsts:srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Kurzor a lap aljára"

#: lazarusidestrconsts:srkmeclineend
msgid "Move cursor to line end"
msgstr "Kurzor a sor végére"

#: lazarusidestrconsts:srkmeclinestart
msgid "Move cursor to line start"
msgstr "Kurzor a sor elejére"

#: lazarusidestrconsts:srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Kurzor a Lap tetejére"

#: lazarusidestrconsts:srkmecpageup
msgid "Move cursor up one page"
msgstr "Kurzor egy lappal feljebb"

#: lazarusidestrconsts:srkmecwordleft
msgid "Move cursor word left"
msgstr "Kurzor a kifejezés bal oldalára"

#: lazarusidestrconsts:srkmecwordright
msgid "Move cursor word right"
msgstr "Kurzor a kifejezés jobb oldalára"

#: lazarusidestrconsts:lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Abhängigkeit nach unten bewegen"

#: lazarusidestrconsts:lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Abhängigkeit nach oben bewegen"

#: lazarusidestrconsts:srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Editor nach links bewegen"

#: lazarusidestrconsts:srkmecmoveeditorright
msgid "Move editor right"
msgstr "Editor nach rechts bewegen"

#: lazarusidestrconsts:lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Einträge zu den abgeleiteten verschieben"

#: lazarusidestrconsts:liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Knoten nach unten bewegen"

#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Knoten eine Ebene nach unten bewegen"

#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Knoten eine Ebene nach oben bewegen"

#: lazarusidestrconsts:liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Knoten nach obenbewegen"

#: lazarusidestrconsts:lispatheditmovepathdown
msgid "Move path down"
msgstr "Pfad nach unten bewegen"

#: lazarusidestrconsts:lispatheditmovepathup
msgid "Move path up"
msgstr "Pfad nach oben bewegen"

#: lazarusidestrconsts:fdmordermovetoback
msgid "Move to back"
msgstr "Hátra mozgat"

#: lazarusidestrconsts:fdmordermovetofront
msgid "Move to front"
msgstr "Előtérbe hoz"

#: lazarusidestrconsts:dlgmultiselect
msgid "Multi Select"
msgstr "Több kijelölése"

#: lazarusidestrconsts:dlgmultiline
msgid "Multiline"
msgstr "Több soros"

#: lazarusidestrconsts:lisfindfilemultiline
msgid "Multiline pattern"
msgstr "Több soros sablon"

#: lazarusidestrconsts:fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Mehrfachselektion nur auf einem Formular möglich."

#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "Megjegyzés: Konnte definiertes Template für Free Pascal Quellenverzeichnis nicht finden"

#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "Megjegyzés: Konnte das Definitons-Template für Lazarus-Quellen nicht Létrehozás"

#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "Megjegyzés: CodeTools-KonfigurationsFájl nincs meg - verwende Voreinstellungen"

#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "Megjegyzés: Régebbi kódoló eszközök beállítás fájl betöltése:"

#: lazarusidestrconsts:liseonoteonlyabsolutepathsaresupportednow
msgid "NOTE: only absolute paths are supported now"
msgstr "Megjegyzés: Csak teljes útvonal van most támogatva"

#: lazarusidestrconsts:lisdebugoptionsfrmname
msgid "Name"
msgstr "Név"

#: lazarusidestrconsts:lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Új eljárás neve"

#: lazarusidestrconsts:liscodetoolsdefsname
msgid "Name:"
msgstr "Név:"

#: lazarusidestrconsts:dlgnaming
msgid "Naming"
msgstr "Elnevezés"

#: lazarusidestrconsts:lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Csak manuálisan"

#: lazarusidestrconsts:lismenutemplatenew
msgid "New"
msgstr "Új"

#: lazarusidestrconsts:lismenunewother
msgid "New ..."
msgstr "Új ..."

#: lazarusidestrconsts:lisnewancestors
msgid "New Ancestors"
msgstr "Új Horgony"

#: lazarusidestrconsts:lisnewclass
msgid "New Class"
msgstr "Új Osztály"

#: lazarusidestrconsts:lisa2pnewcomponent
msgid "New Component"
msgstr "Új komponens"

#: lazarusidestrconsts:lisa2pnewfile
msgid "New File"
msgstr "Új Fájl"

#: lazarusidestrconsts:lismenunewform
msgid "New Form"
msgstr "Új Form"

#: lazarusidestrconsts:lismenunewproject
msgid "New Project ..."
msgstr "Új Projekt ..."

#: lazarusidestrconsts:lismenunewprojectfromfile
msgid "New Project from file ..."
msgstr "Új Projekt fájlból ..."

#: lazarusidestrconsts:lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Új feltétel"

#: lazarusidestrconsts:lismenueditornewtemplatedescription
msgid "New Template Description..."
msgstr "Új Sablonleírás ..."

#: lazarusidestrconsts:lismenunewunit
msgid "New Unit"
msgstr "Új Unit"

#: lazarusidestrconsts:lisa2pnewclassname
msgid "New class name:"
msgstr "Új Osztálynév"

#: lazarusidestrconsts:liskmnewproject
msgid "New project"
msgstr "Új Projekt"

#: lazarusidestrconsts:liskmnewprojectfromfile
msgid "New project from file"
msgstr "Új Projekt Fájlból"

#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Az új Unit nincs a unit könyvtárban"

#: lazarusidestrconsts:liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Új csomópont"

#: lazarusidestrconsts:lispkgmangnewpackage
msgid "NewPackage"
msgstr "Új csomag"

#: lazarusidestrconsts:liscodetoolsoptsnewline
msgid "Newline"
msgstr "Új sor"

#: lazarusidestrconsts:srvk_next
msgid "Next"
msgstr "Következő"

#: lazarusidestrconsts:srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Következő könyvjelző"

#: lazarusidestrconsts:lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "ErőforrásSztring szekció nincs meg"

#: lazarusidestrconsts:lisnobackupfiles
msgid "No backup files"
msgstr "Nincs biztonsági mentés"

#: lazarusidestrconsts:lisnochange
msgid "No change"
msgstr "Nem változtat"

#: lazarusidestrconsts:lisnocodeselected
msgid "No code selected"
msgstr "Nincs kijelölt kód"

#: lazarusidestrconsts:lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Keine abgeleiteten Compilereinstellungen"

#: lazarusidestrconsts:lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Nincs Debugger előírás"

#: lazarusidestrconsts:dlgednoerr
msgid "No errors in key mapping found."
msgstr "Keine Fehler in der Tastaturbelegung gefunden"

#: lazarusidestrconsts:lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Nincs kijelölt elem"

#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr "Kein Package für die Abhängigkeit %s%s%s gefunden.%sBitte wählen Sie ein vorhandenes Package."

#: lazarusidestrconsts:lisoipnopackageselected
msgid "No package selected"
msgstr "Nincs kijelölt csomag"

#: lazarusidestrconsts:lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr "Program Fájl %s%s%s nincs meg."

#: lazarusidestrconsts:lisnostringconstantfound
msgid "No string constant found"
msgstr "Nincs string konstans"

#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly
msgid "Node and its children are only valid for this project"
msgstr "Der Knoten und seine Nachfahren sind nur für dieses Projekt gültig"

#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "A csomópont csak olvasható"

#: lazarusidestrconsts:srvk_nonconvert
msgid "Nonconvert"
msgstr "Nem konvertálható"

#: lazarusidestrconsts:dlgenvnone
msgid "None"
msgstr "Nincs"

#: lazarusidestrconsts:dlgconormal
msgid "Normal Code"
msgstr "Normál Kód"

#: lazarusidestrconsts:srkmecnormalselect
msgid "Normal selection mode"
msgstr "Szokásos kijelölési mód"

#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Normalerweise ist der Filter ein regulärer Ausdruck. Bei *Einfacher Syntax* gilt ein Punkt als normales Zeichen, ein * steht für eine beliebige Zeichenkette, ein ? für ein beliebiges Zeichen, und ein Komma und Semikolon als Trenner zwischen Alternativen. Beispiel: Einfache Syntax *.pas;*.pp bedeutet ^(.*\\.pas|.*\\.pp)$"

#: lazarusidestrconsts:lisnotadelphiproject
msgid "Not a Delphi project"
msgstr "Nem Delphi Projekt"

#: lazarusidestrconsts:lisnotadelphiunit
msgid "Not a Delphi unit"
msgstr "Nem Delphi Unit"

#: lazarusidestrconsts:lisuenotfound
msgid "Not found"
msgstr "Nincs meg"

#: lazarusidestrconsts:uenotimplcap
msgid "Not implemented yet"
msgstr "Nem elérhető"

#: lazarusidestrconsts:lisnotnow
msgid "Not now"
msgstr "Nem most"

#: lazarusidestrconsts:liskmnoteallkeyswillbesettothevaluesofthechoosenscheme
msgid "Note: All keys will be set to the values of the choosen scheme."
msgstr "Megjegyzés: Alle Tasten werden auf die Werte der gewählten Belegung gesetzt."

#: lazarusidestrconsts:dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Megjegyzés: A Projekt könyvtárban minden fájl projekt fájl"

#: lazarusidestrconsts:liscodetoolsoptsnumber
msgid "Number"
msgstr "Szám"

#: lazarusidestrconsts:srvk_numlock
msgid "Numlock"
msgstr "NumLock"

#: lazarusidestrconsts:srvk_numpad
msgid "Numpad %d"
msgstr "Számbillentyűk %d"

#: lazarusidestrconsts:lisifdok
msgid "OK"
msgstr "Rendben"

#: lazarusidestrconsts:lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "OS kivétel"

#: lazarusidestrconsts:uepovr
msgid "OVR"
msgstr "Üb"

#: lazarusidestrconsts:lispckoptsobject
msgid "Object"
msgstr "Objektum"

#: lazarusidestrconsts:lismenuviewobjectinspector
msgid "Object Inspector"
msgstr "Objektum felügyelő"

#: lazarusidestrconsts:liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Objektum felügyelő parancsok"

#: lazarusidestrconsts:lisokbtn
msgid "Ok"
msgstr "OK"

#: lazarusidestrconsts:lisoldancestors
msgid "Old Ancestors"
msgstr "Régi Horgonyok"

#: lazarusidestrconsts:lisoldclass
msgid "Old Class"
msgstr "Előző Osztály"

#: lazarusidestrconsts:lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "Beim Erstellen des Projekts statt dessen \"Fájl erstellen\" aufrufen"

#: lazarusidestrconsts:lisceoonidle
msgid "On idle"
msgstr "Üresjáratban"

#: lazarusidestrconsts:lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "Beim Start des Projekts statt dessen \"Fájl ausführen\" aufrufen"

#: lazarusidestrconsts:lismenuonlinehelp
msgid "Online Help"
msgstr "Internet súgó"

#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented
msgid "Online Help not yet implemented"
msgstr "Online súgó nem elérhető"

#: lazarusidestrconsts:lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Keresés csak teljes szavakra"

#: lazarusidestrconsts:lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Csak a kijelölt"

#: lazarusidestrconsts:lisfindfileonlytextfiles
msgid "Only text files"
msgstr "Csak Szöveg Fájlok"

#: lazarusidestrconsts:lishintopen
msgid "Open"
msgstr "Megnyitás"

#: lazarusidestrconsts:lisopenlfm
msgid "Open %s"
msgstr "Megnyitás %s"

#: lazarusidestrconsts:lismenuopen
msgid "Open ..."
msgstr "Megnyitás ..."

#: lazarusidestrconsts:lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr "Különbség szerkesztő megnyitás"

#: lazarusidestrconsts:liscpopenpackage
msgid "Open Package %s"
msgstr "Csomag %s megnyitása"

#: lazarusidestrconsts:lisopenpackagefile
msgid "Open Package File"
msgstr "Csomagfájl megnyitása"

#: lazarusidestrconsts:lisopenpackage
msgid "Open Package?"
msgstr "Csomag megnyitása?"

#: lazarusidestrconsts:lisctdefsopenpreview
msgid "Open Preview"
msgstr "Előnézet megnyitása"

#: lazarusidestrconsts:lismenuopenproject
msgid "Open Project ..."
msgstr "Projekt megnyitása ..."

#: lazarusidestrconsts:lisopenprojectfile
msgid "Open Project File"
msgstr "Projekt Fájl megnyitása"

#: lazarusidestrconsts:lisopenproject
msgid "Open Project?"
msgstr "Projekt megnyitása?"

#: lazarusidestrconsts:lismenutemplateopenrecent
msgid "Open Recent"
msgstr "Utoló megnyitása"

#: lazarusidestrconsts:lismenuopenrecent
msgid "Open Recent ..."
msgstr "Utolsó megnyitása ..."

#: lazarusidestrconsts:lismenuopenrecentproject
msgid "Open Recent Project ..."
msgstr "Legutóbbi Projektek ..."

#: lazarusidestrconsts:liscpopenunit
msgid "Open Unit %s"
msgstr "Unit %s megnyitása"

#: lazarusidestrconsts:lisopenasxmlfile
msgid "Open as XML file"
msgstr " XML Fájl megnyitása"

#: lazarusidestrconsts:lisopenexistingfile
msgid "Open existing file"
msgstr "Meglévő Fájl megnyitása"

#: lazarusidestrconsts:lisopenfile
msgid "Open file"
msgstr "Fájl megnyitás"

#: lazarusidestrconsts:srkmecopenfileatcursor
msgid "Open file at cursor"
msgstr "Fájl megnyitás kurzornál"

#: lazarusidestrconsts:lismenuopenfilenameatcursor
msgid "Open filename at cursor"
msgstr "Kurzor alatti fájl megnyitása"

#: lazarusidestrconsts:dlgqopenlastprj
msgid "Open last project at start"
msgstr "Legutóbbi Projekt megnyitása indításkor"

#: lazarusidestrconsts:lisoipopenloadedpackage
msgid "Open loaded package"
msgstr "Betöltött csomag megnyitása"

#: lazarusidestrconsts:lismenuopenpackage
msgid "Open loaded package ..."
msgstr "Betöltött csomag megnyitása ..."

#: lazarusidestrconsts:lisiecoopenorloadcompileroptions
msgid "Open or Load Compiler Options"
msgstr "Fordító beállítások megnyitása vagy betöltése"

#: lazarusidestrconsts:liscomppalopenpackage
msgid "Open package"
msgstr "Csomag megnyitása"

#: lazarusidestrconsts:liskmopenpackagefile
msgid "Open package file"
msgstr "Csomag Fájl megnyitása"

#: lazarusidestrconsts:lismenuopenpackagefile
msgid "Open package file (.lpk) ..."
msgstr "Csomag Fájl (.lpk) megnyitása ..."

#: lazarusidestrconsts:lismenuopenpackageofcurunit
msgid "Open package of current unit"
msgstr "Package der aktuellen Unit öffnen"

#: lazarusidestrconsts:lisopenproject2
msgid "Open project"
msgstr "Projekt megnyitása"

#: lazarusidestrconsts:lisopenprojectagain
msgid "Open project again"
msgstr "Projekt megnyitása ismét"

#: lazarusidestrconsts:lisiecoopenrecent
msgid "Open recent"
msgstr "Legutóbbi megnyitása"

#: lazarusidestrconsts:lismenuopenrecentpkg
msgid "Open recent package ..."
msgstr "Legutóbbi csomag megnyitása ..."

#: lazarusidestrconsts:lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Fájl megnyitása forrásként"

#: lazarusidestrconsts:lisopenthepackage
msgid "Open the package %s?"
msgstr "A csomagfájl %s megnyitása?"

#: lazarusidestrconsts:lisopentheproject
msgid "Open the project %s?"
msgstr "A Projekt %s megnyitása?"

#: lazarusidestrconsts:liscomppalopenunit
msgid "Open unit"
msgstr "Unit megnyitása"

#: lazarusidestrconsts:dlgoptimiz
msgid "Optimizations:"
msgstr "Optimalizáció:"

#: lazarusidestrconsts:liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr "A beállítás a pozición %d nem enged egy paramétert: %s"

#: lazarusidestrconsts:liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr "Die Option an der Position %s benötigt einen Parameter: %s"

#: lazarusidestrconsts:fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Beállítás: Rácshoz illesztés"

#: lazarusidestrconsts:fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Beállítás: Segédvonalhoz illesztés"

#: lazarusidestrconsts:dlgfropts
msgid "Options"
msgstr "Beállítások"

#: lazarusidestrconsts:lislazbuildoptions
msgid "Options:"
msgstr "Beállítások:"

#: lazarusidestrconsts:dlgcoopts
msgid "Options: "
msgstr "Beállítások:"

#: lazarusidestrconsts:fdmorder
msgid "Order"
msgstr "Utasítás"

#: lazarusidestrconsts:dlgsrorigin
msgid "Origin"
msgstr "Eredet"

#: lazarusidestrconsts:dlgcoother
msgid "Other"
msgstr "Egyéb"

#: lazarusidestrconsts:dlgcosources
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Egyéb forrás (.pp-/.pas-Fájlen, nur von der IDE benutzt, nicht vom Compiler)"

#: lazarusidestrconsts:dlgotherunitfiles
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgstr "Egyéb Unit Fájlok (-Fu) (Sorlezárás pontosvessző):"

#: lazarusidestrconsts:dlgenvotherfiles
msgid "Other files"
msgstr "Egyéb Fájlok"

#: lazarusidestrconsts:lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Kimenet"

#: lazarusidestrconsts:dlgpooutputsettings
msgid "Output Settings"
msgstr "Kimeneti beállítások"

#: lazarusidestrconsts:lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Kimeneti könyvtár"

#: lazarusidestrconsts:dlgcooverflow
msgid "Overflow"
msgstr "Túlcsordulás"

#: lazarusidestrconsts:lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "Sprache überschreiben. Beispielsweise --language=de. Für die möglichen Werte siehe die Fájlen im Verzeichnis \"languages\"."

#: lazarusidestrconsts:lissvuooverridesystemvariable
msgid "Override system Variable"
msgstr "System Változó felülírása"

#: lazarusidestrconsts:srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Felülírásos Mód"

#: lazarusidestrconsts:lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Fájl felülírása"

#: lazarusidestrconsts:lisoverwritefile
msgid "Overwrite file?"
msgstr "Fájl felülírása?"

#: lazarusidestrconsts:lispackage
msgid "Package"
msgstr "Csomag"

#: lazarusidestrconsts:lispckeditpackage
msgid "Package %s"
msgstr "Csomag %s"

#: lazarusidestrconsts:lispckexplpackagenotfound
msgid "Package %s not found"
msgstr "Csomag %s nincs meg"

#: lazarusidestrconsts:lispkgmangpackagechangedsave
msgid "Package %s%s%s changed. Save?"
msgstr "Csomag %s%s%s megváltozott. Mentés?"

#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr "Csomag %s%s%s megváltozott. %sMenti a csomagot?"

#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
msgstr "Csomag %s%s%s érvénytelen könyvtár:%s%s%s%s"

#: lazarusidestrconsts:lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr "Csomag %s%s%s nincs meg."

#: lazarusidestrconsts:lismenupackagegraph
msgid "Package Graph ..."
msgstr "Csomag figyelő ..."

#: lazarusidestrconsts:lispackageinfo
msgid "Package Info"
msgstr "Csomag Info"

#: lazarusidestrconsts:lisoippackagename
msgid "Package Name"
msgstr "Csomag név"

#: lazarusidestrconsts:lisprojaddpackagename
msgid "Package Name:"
msgstr "Csomag Név:"

#: lazarusidestrconsts:lispckoptspackageoptions
msgid "Package Options"
msgstr "Csomag beállítások"

#: lazarusidestrconsts:lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Csomag forrás célkönyvtár"

#: lazarusidestrconsts:lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Csomag ütközés"

#: lazarusidestrconsts:lispkgmangpackagefilemissing
msgid "Package file missing"
msgstr "Ismeretlen Csomag Fájl"

#: lazarusidestrconsts:lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Csomagfájl nincs meg"

#: lazarusidestrconsts:lispkgmangpackagefilenotsaved
msgid "Package file not saved"
msgstr "Csomag Fájl nincs mentve"

#: lazarusidestrconsts:liskmpackagegraph
msgid "Package graph"
msgstr "Csomag figyelő"

#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage
msgid "Package is no designtime package"
msgstr "Package ist kein Entwicklungszeit-Package"

#: lazarusidestrconsts:lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "A csomag csak olvasható"

#: lazarusidestrconsts:lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Szükséges csomag"

#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Ilyen csomagnév már van"

#: lazarusidestrconsts:lispackageneedsinstallation
msgid "Package needs installation"
msgstr "A csomagot installálni kell"

#: lazarusidestrconsts:lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Csomag nincs meg"

#: lazarusidestrconsts:lispkgmangpackage
msgid "Package: %s"
msgstr "Csomag: %s"

#: lazarusidestrconsts:lispckoptspackagetype
msgid "PackageType"
msgstr "Csomag Típus"

#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "A csomag kiterjesztése .lpk kell legyen."

#: lazarusidestrconsts:lispackagestoinstallintheide
msgid "Packages to install in the IDE"
msgstr "Csomag installálása az IDE-be"

#: lazarusidestrconsts:lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Oldalnév túl hosszú"

#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Zeichne Designerelemente nur wenn nicht beschäftigt (reduziert Prozessorbelastung, für langsamerere Rechner)"

#: lazarusidestrconsts:lisa2ppalettepage
msgid "Palette Page:"
msgstr "Palettenseite:"

#: lazarusidestrconsts:lissortselparagraphs
msgid "Paragraphs"
msgstr "Szakasz"

#: lazarusidestrconsts:liscmparameter
msgid "Parameter"
msgstr "Paraméter"

#: lazarusidestrconsts:lisedtexttoolparameters
msgid "Parameters:"
msgstr "Paraméter:"

#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node can not contain child nodes."
msgstr "Elternknoten kann keine Kindknoten enthalten."

#: lazarusidestrconsts:dlgcoparsing
msgid "Parsing"
msgstr "Elemzés"

#: lazarusidestrconsts:lispascalsourcefile
msgid "Pascal source file"
msgstr "Pascal Forrás Fájl"

#: lazarusidestrconsts:lispascalunit
msgid "Pascal unit"
msgstr "Pascal Unit"

#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Pascal Unit kiterjesztése .pp vagy .pas kell legyen"

#: lazarusidestrconsts:dlgpassoptslinker
msgid "Pass Options To The Linker (Delimiter is space)"
msgstr "Dem Linker zusätzliche Einstellungen übergeben (Leerzeichen trennt)"

#: lazarusidestrconsts:lismenupaste
msgid "Paste"
msgstr "Beillesztés"

#: lazarusidestrconsts:liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr "Komponens beillesztése vágólapról"

#: lazarusidestrconsts:srkmecpaste
msgid "Paste clipboard to current position"
msgstr "Beillesztés vágólapról az aktuális pozicióra "

#: lazarusidestrconsts:lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Kijelölt Komponensek beillesztése vágólapról"

#: lazarusidestrconsts:lispatheditpathtemplates
msgid "Path templates"
msgstr "Pfad-Templates"

#: lazarusidestrconsts:listofpcpath
msgid "Path:"
msgstr "Útvonal:"

#: lazarusidestrconsts:dlgsearchpaths
msgid "Paths"
msgstr "Útvonalak"

#: lazarusidestrconsts:lisuidpathsreadonly
msgid "Paths (Read Only)"
msgstr "Útvonalak (Csak olvasható)"

#: lazarusidestrconsts:lismenupause
msgid "Pause"
msgstr "Szünet"

#: lazarusidestrconsts:srvk_pause
msgid "Pause key"
msgstr "Szünet gomb"

#: lazarusidestrconsts:liskmpauseprogram
msgid "Pause program"
msgstr "Program futás felfüggesztve"

#: lazarusidestrconsts:dlgpersistentcaret
msgid "Persistent caret"
msgstr "Állandó kurzor"

#: lazarusidestrconsts:lisplzcheckthecompilername
msgid "Please check the compiler name"
msgstr "Kérem ellenőrizze a fordító nevét"

#: lazarusidestrconsts:lisplzcheckthefpcsourcedirectory
msgid "Please check the freepascal source directory"
msgstr "Ellenőrizze a freepascal forráskönyvtárat"

#: lazarusidestrconsts:lismakeresstrpleasechoosearesourstring
msgid "Please choose a resourstring section from the list."
msgstr "Válasszon egy erőforrásstring szakaszt a listából."

#: lazarusidestrconsts:lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Kérem nyisson egy unitot mielőtt futtat"

#: lazarusidestrconsts:srkmpresskey
msgid "Please press a key ..."
msgstr "Nyomjon egy billentyűt ..."

#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Kérem mentse a fájlt mielőtt hozzáadja a csomaghoz."

#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst
msgid "Please save the package first."
msgstr "Kérem először mentse a csomagot."

#: lazarusidestrconsts:lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Csomag kiválasztása"

#: lazarusidestrconsts:lisoippleaseselectapackagetoopen
msgid "Please select a package to open"
msgstr "Csomag kiválasztása megnyitásra"

#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Először válasszon egy elemet."

#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Bitte selektieren Sie Quellentext um eine Új Prozedur/Methode zu extrahieren."

#: lazarusidestrconsts:liscodetoolsoptspoint
msgid "Point"
msgstr "Pont"

#: lazarusidestrconsts:rslanguagepolish
msgid "Polish"
msgstr "Lengyel"

#: lazarusidestrconsts:rslanguagepolishwin
msgid "Polish(CP1250)"
msgstr "Lengyel (CP1250)"

#: lazarusidestrconsts:rslanguagepolishiso
msgid "Polish(ISO 8859-2)"
msgstr "Lengyel (ISO 8859-2)"

#: lazarusidestrconsts:rslanguageportugues
msgid "Portuguese"
msgstr "Portugál"

#: lazarusidestrconsts:dlgwrdpreview
msgid "Preview"
msgstr "Előnézet"

#: lazarusidestrconsts:dlgcdtpreview
msgid "Preview (Max line length = 1)"
msgstr "Előnézet (Maximális sorhossz = 1)"

#: lazarusidestrconsts:srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Előző könyvjelző"

#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Az előző csomópont nem tartalmaz utódcsomópontot."

#: lazarusidestrconsts:srvk_print
msgid "Print"
msgstr "Nyomtatás"

#: lazarusidestrconsts:listodolistprintlist
msgid "Print todo items"
msgstr "ToDo elemek nyomtatása"

#: lazarusidestrconsts:srvk_prior
msgid "Prior"
msgstr "Elsőbbség"

#: lazarusidestrconsts:lisprivatemethod
msgid "Private Method"
msgstr "Privát Metódus"

#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti
msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
msgstr "Möglicherweise müssen sie einige Package installieren bevor Sie fortfahren können.%s%sFigyelem:%sDas Projekt bezieht sich auf einige Packages die Units mit Register-Prozeduren enthalten. Die Register-Prozedur dient normalerweise dazu, Komponenten in der IDE zu installieren. Aber die folgenden Units gehören zu Packages, die noch nicht in der IDE installiert sind. Wenn Sie verKeresésn, ein Form in der IDE zu öffnen das solche Komponenten verwendet werden Sie Fehlermeldungen wegen nincs meger Komponenten erhalten und der Ladeprozeß des Forms wird mit möglicherweise unschönen Ergebnissen enden.%s%sDas hat keinen Einfluß auf das öffnen des Projekts oder beliebiger zugehörigen Quellen.%s%sEs bedeutet nur, daß es keine gute Idee ist, das Form für das Design zu öffnen bevor die bemängelten Packages installiert wurden.%s%s"

#: lazarusidestrconsts:lisprocedure
msgid "Procedure"
msgstr "Eljárás"

#: lazarusidestrconsts:uemprocedurejump
msgid "Procedure Jump"
msgstr "Deklarációhoz ugrás"

#: lazarusidestrconsts:srkmecprocedurelist
msgid "Procedure List ..."
msgstr "Eljárás Lista ..."

#: lazarusidestrconsts:dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Prozedur-Einfügerichtlinie"

#: lazarusidestrconsts:lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Prozedur mit Schnittstelle"

#: lazarusidestrconsts:lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Processz"

#: lazarusidestrconsts:lisprogram
msgid "Program"
msgstr "Program"

#: lazarusidestrconsts:lisprogramdetected
msgid "Program detected"
msgstr "Azonosított Program"

#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgstr "A Program forrásfájl pascal kiterjesztésű kell legyen - .pas, .pp vagy .lpr"

#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic
msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
msgstr "Program%sEgy free pascal program. A programfájlokat a Lazarus támogatja."

#: lazarusidestrconsts:lisedtexttoolprogramfilename
msgid "Programfilename:"
msgstr "Program Fájl név:"

#: lazarusidestrconsts:lispdprogress
msgid "Progress"
msgstr "Folyamatban"

#: lazarusidestrconsts:dlgenvproject
msgid "Project"
msgstr "Projekt"

#: lazarusidestrconsts:lisprojectsuccessfullybuilt
msgid "Project %s%s%s successfully built. :)"
msgstr "Projekt %s%s%s sikeres fordítás. :)"

#: lazarusidestrconsts:lisedtdefprojectincpath
msgid "Project IncPath"
msgstr "Projekt-Includepfad"

#: lazarusidestrconsts:lisprojectincpath
msgid "Project Include Path"
msgstr "Projekt Include útvonal"

#: lazarusidestrconsts:lisprojectinformation
msgid "Project Information"
msgstr "Projekt Információ"

#: lazarusidestrconsts:lismenuprojectinspector
msgid "Project Inspector"
msgstr "Projektfelügyelő ..."

#: lazarusidestrconsts:lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Projektfelügyelő - %s"

#: lazarusidestrconsts:dlgprojectoptions
msgid "Project Options"
msgstr "Projekt beállítások"

#: lazarusidestrconsts:lismenuprojectoptions
msgid "Project Options ..."
msgstr "Projekt beállítások ..."

#: lazarusidestrconsts:lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "Projekt forrás célkönyvtár"

#: lazarusidestrconsts:lisprojectsrcpath
msgid "Project Src Path"
msgstr "Projekt forrás útvonal"

#: lazarusidestrconsts:lisedtdefprojectsrcpath
msgid "Project SrcPath"
msgstr "Projekt forrás útvonal"

#: lazarusidestrconsts:lisprojectunitpath
msgid "Project Unit Path"
msgstr "Projekt Unit útvonal"

#: lazarusidestrconsts:lisedtdefprojectunitpath
msgid "Project UnitPath"
msgstr "Projekt Unit útvonal"

#: lazarusidestrconsts:lisprojectchanged
msgid "Project changed"
msgstr "Projekt váltás"

#: lazarusidestrconsts:lisprojectclosed
msgid "Project closed"
msgstr "Projekt bezárva"

#: lazarusidestrconsts:lisprojectdirectory
msgid "Project directory"
msgstr "Projekt könyvtár"

#: lazarusidestrconsts:lisprojectfilename
msgid "Project filename"
msgstr "Projekt fájl név"

#: lazarusidestrconsts:dlgprojfiles
msgid "Project files"
msgstr "Projekt fájlok"

#: lazarusidestrconsts:lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Azonosított Projekt info Fájl"

#: lazarusidestrconsts:lisprojectisrunnable
msgid "Project is runnable"
msgstr "A Projekt futtatható"

#: lazarusidestrconsts:lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Projekt Makró tulajdonságok"

#: lazarusidestrconsts:srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Projekt menüparancsok"

#: lazarusidestrconsts:lispkgmangproject
msgid "Project: %s"
msgstr "Projekt: %s"

#: lazarusidestrconsts:dlgpromptonreplace
msgid "Prompt On Replace"
msgstr "Nachfragen beim Ersetzen"

#: lazarusidestrconsts:lispromptforvalue
msgid "Prompt for value"
msgstr "Benutzer nach Daten fragen"

#: lazarusidestrconsts:lishlpoptsproperties
msgid "Properties:"
msgstr "Tulajdonságok"

#: lazarusidestrconsts:dlgpropertycompletion
msgid "Property completion"
msgstr "Tulajdonság kiegészítés"

#: lazarusidestrconsts:dlgpropnamecolor
msgid "Property name"
msgstr "Tulajdonság név"

#: lazarusidestrconsts:lisprotectedmethod
msgid "Protected Method"
msgstr "Protected Metódus"

#: lazarusidestrconsts:lispublicmethod
msgid "Public Method"
msgstr "Publikus Metódus"

#: lazarusidestrconsts:lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Publikus csomag"

#: lazarusidestrconsts:lismenupublishproject
msgid "Publish Project ..."
msgstr "Projekt kiadás ..."

#: lazarusidestrconsts:liskmpublishproject
msgid "Publish project"
msgstr "Projekt kiadás"

#: lazarusidestrconsts:lispublishprojdir
msgid "Publish project directory"
msgstr "Kiadott Projekt könyvtár"

#: lazarusidestrconsts:lispublishedmethod
msgid "Published Method"
msgstr "Publikus Metódus"

#: lazarusidestrconsts:lismenuquickcompile
msgid "Quick compile"
msgstr "Gyors fordítás"

#: lazarusidestrconsts:liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Gyors fordítás, linkelés nélkül"

#: lazarusidestrconsts:lismenuquicksyntaxcheck
msgid "Quick syntax check"
msgstr "Szintaktikai ellenőrzés"

#: lazarusidestrconsts:lismenuquit
msgid "Quit"
msgstr "&Kilépés"

#: lazarusidestrconsts:lisquitlazarus
msgid "Quit Lazarus"
msgstr "Lazarus bezárása"

#: lazarusidestrconsts:dlgcorange
msgid "Range"
msgstr "Tartomány"

#: lazarusidestrconsts:lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Függőségek újra hozzáadása"

#: lazarusidestrconsts:lispckeditreaddfile
msgid "Re-Add file"
msgstr "Fájl újra hozzáadása"

#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Újrafordítás minden szükséges csomaggal együtt?"

#: lazarusidestrconsts:lisreaderror
msgid "Read Error"
msgstr "Olvasási hiba"

#: lazarusidestrconsts:uemreadonly
msgid "Read Only"
msgstr "Csak olvasható"

#: lazarusidestrconsts:lispckeditreadonly
msgid "Read Only: %s"
msgstr "Csak olvasható: %s"

#: lazarusidestrconsts:liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Olvasás Hiba"

#: lazarusidestrconsts:dlgcdtreadprefix
msgid "Read prefix"
msgstr "Prefix olvasás"

#: lazarusidestrconsts:uepreadonly
msgid "Readonly"
msgstr "Csak olvasható"

#: lazarusidestrconsts:lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Lazarus újra fordítása?"

#: lazarusidestrconsts:lisiecorecentfiles
msgid "Recent files"
msgstr "Legutóbbi fájlok"

#: lazarusidestrconsts:lispckeditrecompileallrequired
msgid "Recompile all required"
msgstr "Minden szükséges újrafordítása"

#: lazarusidestrconsts:lispckeditrecompileclean
msgid "Recompile clean"
msgstr "Hibátlan újrafordítás"

#: lazarusidestrconsts:lismenuredo
msgid "Redo"
msgstr "Ismét"

#: lazarusidestrconsts:lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Aktualisieren des Designer verringern"

#: lazarusidestrconsts:uemrefactor
msgid "Refactoring"
msgstr "Refactoring"

#: lazarusidestrconsts:dlgreferencecolor
msgid "Reference"
msgstr "Hivatkozás"

#: lazarusidestrconsts:dlgunitdeprefresh
msgid "Refresh"
msgstr "Frissítés"

#: lazarusidestrconsts:lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Automatikus frissítés"

#: lazarusidestrconsts:listodolistrefresh
msgid "Refresh todo items"
msgstr "Todo elemek frissítése"

#: lazarusidestrconsts:lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "Registerprozedur ist NIL"

#: lazarusidestrconsts:lispckeditregisterunit
msgid "Register unit"
msgstr "Unit Regisztrálás"

#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "RegisterUnit wurde aufgerufen aber kein Package registriert."

#: lazarusidestrconsts:lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Beépülők regisztrálása"

#: lazarusidestrconsts:lispkgsysregistrationerror
msgid "Registration Error"
msgstr "Regisztrálási Hiba"

#: lazarusidestrconsts:dlgregularexpressions
msgid "Regular Expressions"
msgstr "Reguláris kifejezések"

#: lazarusidestrconsts:lisfindfileregularexpressions
msgid "Regular expressions"
msgstr "Reguláris kifejezések"

#: lazarusidestrconsts:lisrelativepaths
msgid "Relative paths"
msgstr "Relatív útvonal"

#: lazarusidestrconsts:lispckoptsrelease
msgid "Release"
msgstr "Kiadás"

#: lazarusidestrconsts:lisdiskdiffrevertall
msgid "Reload from disk"
msgstr "Ismételt betöltés"

#: lazarusidestrconsts:lisexttoolremove
msgid "Remove"
msgstr "Eltávolítás"

#: lazarusidestrconsts:lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Függőség eltávolítása?"

#: lazarusidestrconsts:liskmremoveactiveunitfromproject
msgid "Remove active unit from project"
msgstr "Aktív Unit eltávolítása a Projektből"

#: lazarusidestrconsts:lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Minden érvénytelen tulajdonság eltávolítása"

#: lazarusidestrconsts:liskmremovebreakpoint
msgid "Remove break point"
msgstr "Megszakítás pont eltávolítása"

#: lazarusidestrconsts:lispckeditremovedependency
msgid "Remove dependency"
msgstr "Függőség eltávolítás"

#: lazarusidestrconsts:lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr "Abhängigkeit %s%s%s%saus dem package %s%s%s entfernen?"

#: lazarusidestrconsts:lispckeditremovefile
msgid "Remove file"
msgstr "Fájl eltávolítása"

#: lazarusidestrconsts:lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr " %s Fájl eltávolítása a Projektből?"

#: lazarusidestrconsts:lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr "Fájl eltávolítása %s%s%s%s a csomagból %s%s%s?"

#: lazarusidestrconsts:lispckeditremovefile2
msgid "Remove file?"
msgstr "Fájl eltávolítása?"

#: lazarusidestrconsts:liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Entfernen der Fájlen auf die der Filter paßt"

#: lazarusidestrconsts:lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Eltávolítás a Projektből ..."

#: lazarusidestrconsts:lisoifremovefromfavouriteproperties
msgid "Remove from favourite properties"
msgstr "Eltávolítás a kedvenc tulajdonságok közül"

#: lazarusidestrconsts:lisremovefromproject
msgid "Remove from project"
msgstr "Eltávolítás a Projektből"

#: lazarusidestrconsts:lislazdocdeletepathbutton
msgid "Remove path"
msgstr "Útvonal eltávolítása"

#: lazarusidestrconsts:lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Kijelölt elem eltávolítása"

#: lazarusidestrconsts:lisremovethem
msgid "Remove them"
msgstr "Eltávolítás"

#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
msgid "Removed Files (these entries are not saved to the lpk file)"
msgstr "Eltávolított Fájlok (ezt a bejegyzést nem mentette .lpk fájlba)"

#: lazarusidestrconsts:lisprojinspremovedrequiredpackages
msgid "Removed required packages"
msgstr "Törölt szükséges csomagok"

#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved
msgid "Removed required packages (these entries are not saved to the lpk file)"
msgstr "Eltávolított szükséges csomagok (ezt a bejegyzést nem mentette .lpk fájlba)"

#: lazarusidestrconsts:lisfrirename
msgid "Rename"
msgstr "Átnevezés"

#: lazarusidestrconsts:lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "Fájl átnevezése kisbetűsre?"

#: lazarusidestrconsts:uemrenameidentifier
msgid "Rename Identifier"
msgstr "Azonosító átnevezése"

#: lazarusidestrconsts:lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Azonosító átnevezése ..."

#: lazarusidestrconsts:lisfrirenameallreferences
msgid "Rename all References"
msgstr "Minden hivatkozás átnevezése"

#: lazarusidestrconsts:lisrenamefilefailed
msgid "Rename file failed"
msgstr "Fájl átnevezés sikertelen"

#: lazarusidestrconsts:lispkgmangrenamefileinpackage
msgid "Rename file in package?"
msgstr "Fájl átnevezése a csomagban?"

#: lazarusidestrconsts:lisrenamefile
msgid "Rename file?"
msgstr "Fájl átnevezése?"

#: lazarusidestrconsts:srkmecrenameidentifier
msgid "Rename identifier"
msgstr "Azonosító átnevezése"

#: lazarusidestrconsts:lisfrirenameto
msgid "Rename to"
msgstr "Átnevezés"

#: lazarusidestrconsts:lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Átnevezés kisbetűsre"

#: lazarusidestrconsts:lismenureplace
msgid "Replace"
msgstr "Csere"

#: lazarusidestrconsts:dlgreplaceall
msgid "Replace &All"
msgstr "&Összes cseréje"

#: lazarusidestrconsts:lismenureplace2
msgid "Replace ..."
msgstr "Csere ..."

#: lazarusidestrconsts:lispkgmangreplacefile
msgid "Replace File"
msgstr "Fájl áthelyezése"

#: lazarusidestrconsts:lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr "Kicseréli a meglévő %s%s%s?"

#: lazarusidestrconsts:srkmecreplace
msgid "Replace text"
msgstr "Szöveg áthelyezése"

#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr "Dieses Vorkommen von %s%s%s%s mit %s%s%s ersetzen?"

#: lazarusidestrconsts:lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Kijelölt átnevezése sikertelen."

#: lazarusidestrconsts:dlgreport
msgid "Report"
msgstr "Jelentés"

#: lazarusidestrconsts:lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Szükséges csomagok"

#: lazarusidestrconsts:lismenurescanfpcsourcedirectory
msgid "Rescan FPC source directory"
msgstr "FPC forráskönyvtár újrakeresése"

#: lazarusidestrconsts:lismenuresetdebugger
msgid "Reset debugger"
msgstr "Hibakereső visszaállítása"

#: lazarusidestrconsts:lisresourceloaderror
msgid "Resource load error"
msgstr "Erőforrás betöltési hiba"

#: lazarusidestrconsts:lisresourcesaveerror
msgid "Resource save error"
msgstr "Erőforrás mentési hiba"

#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Ilyen erőforrásstring már van"

#: lazarusidestrconsts:lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Erőforrásstring szakasz:"

#: lazarusidestrconsts:lismenurestart
msgid "Restart"
msgstr "Újraindítás"

#: lazarusidestrconsts:lislazbuildrestartafterbuild
msgid "Restart After Successfull Build"
msgstr "Újraindítás fordítás után"

#: lazarusidestrconsts:rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "Ablakhelyzet visszaállítása"

#: lazarusidestrconsts:rsiwprestorewindowsize
msgid "Restore window size"
msgstr "Ablakméret visszaállítása"

#: lazarusidestrconsts:lisdebugoptionsfrmresume
msgid "Resume"
msgstr "Folytatás"

#: lazarusidestrconsts:lisdebugoptionsfrmresumehandled
msgid "Resume Handled "
msgstr "Kezelés folytatása"

#: lazarusidestrconsts:lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "Unbehandelt fortsetzen"

#: lazarusidestrconsts:srvk_return
msgid "Return"
msgstr "Vissza"

#: lazarusidestrconsts:lismenurevert
msgid "Revert"
msgstr "Visszaállítás"

#: lazarusidestrconsts:lisrevertfailed
msgid "Revert failed"
msgstr "Visszaállítás sikertelen"

#: lazarusidestrconsts:lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Csomag visszaállítása?"

#: lazarusidestrconsts:srvk_right
msgid "Right"
msgstr "Jobb"

#: lazarusidestrconsts:dlgrightclickselects
msgid "Right Click selects"
msgstr "Kijelölés jobb klikkel"

#: lazarusidestrconsts:lisrightanchoring
msgid "Right anchoring"
msgstr "Jobb horgony"

#: lazarusidestrconsts:lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Rechter Randabstand. Der Wert wird zum Grund-Randabstand addiert und für den Platz rechts vom Element verwendet."

#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
msgid "Right click on the items tree to get the popupmenu with all available package functions."
msgstr "Rechtsklick auf den Baum der Einträge zeigt das Popup-Menü mit allen verfügbaren Csomag Funktionen."

#: lazarusidestrconsts:dlgrightmargin
msgid "Right margin"
msgstr "Jobb oldali margó"

#: lazarusidestrconsts:dlgrightmargincolor
msgid "Right margin color"
msgstr "Jobb margó színe"

#: lazarusidestrconsts:dlgrightmousemovescursor
msgid "Right mouse moves caret"
msgstr "Rechtsklick bewegt den Cursor"

#: lazarusidestrconsts:lisrightsides
msgid "Right sides"
msgstr "Jobb oldal"

#: lazarusidestrconsts:lisrightspaceequally
msgid "Right space equally"
msgstr "Jobb térköz egyforma"

#: lazarusidestrconsts:dlgrubberbandgroup
msgid "Rubber band"
msgstr "Gumiszallag"

#: lazarusidestrconsts:lismenuprojectrun
msgid "Run"
msgstr "Futtatás"

#: lazarusidestrconsts:lisbfruncommand
msgid "Run Command"
msgstr "Futtatás Parancs"

#: lazarusidestrconsts:lismenurunfile
msgid "Run File"
msgstr "Fájl futtatása"

#: lazarusidestrconsts:lismenurunparameters
msgid "Run Parameters ..."
msgstr "Futtatási paraméterek ..."

#: lazarusidestrconsts:srkmcatrunmenu
msgid "Run menu commands"
msgstr "Futtatás menü parancsok"

#: lazarusidestrconsts:dlgrunparameters
msgid "Run parameters"
msgstr "Futtatási paraméterek"

#: lazarusidestrconsts:liskmrunprogram
msgid "Run program"
msgstr "Program futtatása"

#: lazarusidestrconsts:lismenuruntocursor
msgid "Run to cursor"
msgstr "Futtat kurzortól"

#: lazarusidestrconsts:lisruntofailed
msgid "Run-to failed"
msgstr ""

#: lazarusidestrconsts:lispckoptsruntimeonly
msgid "Runtime only"
msgstr "Csak futásidőben"

#: lazarusidestrconsts:rslanguagerussian
msgid "Russian"
msgstr "Orosz"

#: lazarusidestrconsts:lissvnrevision
msgid "SVN Revision: "
msgstr "SVN Átdolgozás:"

#: lazarusidestrconsts:dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Egyforma nevek (alkönyvtárban)"

#: lazarusidestrconsts:lismenusave
msgid "Save"
msgstr "Mentés"

#: lazarusidestrconsts:lissavespace
msgid "Save "
msgstr "Mentés"

#: lazarusidestrconsts:lissave
msgid "Save ..."
msgstr "Mentés ..."

#: lazarusidestrconsts:lismenusaveall
msgid "Save All"
msgstr "Összes mentése"

#: lazarusidestrconsts:lismenutemplatesaveas
msgid "Save As"
msgstr "Mentés másként ..."

#: lazarusidestrconsts:dlgcharcasefileact
msgid "Save As - auto rename pascal files lower case"
msgstr "Mentés másként (Pascal Fájlok átnevezése kisbetűsre)"

#: lazarusidestrconsts:lismenusaveas
msgid "Save As ..."
msgstr "Mentés másként ..."

#: lazarusidestrconsts:lismenueditorsaveastemplate
msgid "Save As Template..."
msgstr "Minta mentése másként ..."

#: lazarusidestrconsts:lispckeditsavechanges
msgid "Save Changes?"
msgstr "Változások mentése?"

#: lazarusidestrconsts:lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Csomag %s (*.lpk) mentése?"

#: lazarusidestrconsts:lispkgmangsavepackage
msgid "Save Package?"
msgstr "Csomag mentése?"

#: lazarusidestrconsts:lismenusaveproject
msgid "Save Project"
msgstr "Projekt mentése"

#: lazarusidestrconsts:lissaveprojectlpi
msgid "Save Project %s (*.lpi)"
msgstr "Projekt mentése %s (*.lpi)"

#: lazarusidestrconsts:lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Projekt mentése másként ..."

#: lazarusidestrconsts:lissavesettings
msgid "Save Settings"
msgstr "Beállítások mentése"

#: lazarusidestrconsts:lishintsaveall
msgid "Save all"
msgstr "Minden mentése"

#: lazarusidestrconsts:lissaveallmessagestofile
msgid "Save all messages to file"
msgstr "Minden üzenet fájlba mentése"

#: lazarusidestrconsts:liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Mentés és Kilépés"

#: lazarusidestrconsts:lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Mentés és kilépés"

#: lazarusidestrconsts:lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Mentés, és az IDE újrafordítása"

#: lazarusidestrconsts:lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Menti a %s Projekt változtatásait?"

#: lazarusidestrconsts:lissavechanges
msgid "Save changes?"
msgstr "Változások mentése?"

#: lazarusidestrconsts:dlgsavedfile
msgid "Save desktop settings to file"
msgstr "Asztalbeállítások fájlba mentése"

#: lazarusidestrconsts:dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Editorinformationen für geschlossene Fájlen speichern"

#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr "Editorinformationen von Nicht-Projekt-Fájlen sichern"

#: lazarusidestrconsts:dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Editorinformationen nur für ProjektFájlen speichern"

#: lazarusidestrconsts:lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr "Speichern der Fájl %s%s%s%svor dem Schließen des Formulars %s%s%s?"

#: lazarusidestrconsts:lissavefileas
msgid "Save file as"
msgstr "Fájl mentése másként"

#: lazarusidestrconsts:lisa2psavefiledialog
msgid "Save file dialog"
msgstr "Fájl mentés dialógus"

#: lazarusidestrconsts:fdmsaveformasxml
msgid "Save form as xml"
msgstr "Form mentése xml formátumba"

#: lazarusidestrconsts:lisposaveinlpifil
msgid "Save in .lpi file"
msgstr ".lpi Fájlba mentés"

#: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "lps-Fájl im Projektverzeichnis speichern"

#: lazarusidestrconsts:lisposaveinideconfigdirectory
msgid "Save in IDE config directory"
msgstr "Im IDE-Konfigurationsverzeichnis speichern"

#: lazarusidestrconsts:lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr "Info geschlossener EditorFájlen speichern"

#: lazarusidestrconsts:lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Üzenetek fájlba mentése (*.txt)"

#: lazarusidestrconsts:lispckeditsavepackage
msgid "Save package"
msgstr "Csomag mentése"

#: lazarusidestrconsts:lispkgmangsavepackage2
msgid "Save package?"
msgstr "Csomag mentése?"

#: lazarusidestrconsts:liskmsaveproject
msgid "Save project"
msgstr "Projekt mentése"

#: lazarusidestrconsts:liskmsaveprojectas
msgid "Save project as"
msgstr "Projekt mentése másként"

#: lazarusidestrconsts:lisposavesessioninformationin
msgid "Save session information in"
msgstr "Sitzungsinformationen speichern in"

#: lazarusidestrconsts:lislazbuildsavesettings
msgid "Save settings"
msgstr "Beállítások mentése"

#: lazarusidestrconsts:lisiecosavetofile
msgid "Save to file"
msgstr "Mentés Fájlba"

#: lazarusidestrconsts:lisiecosavetorecent
msgid "Save to recent"
msgstr "Zu den zuletzt geöffneten Fájlen hinzufügen"

#: lazarusidestrconsts:liskmsaveall
msgid "SaveAll"
msgstr "Minden mentése"

#: lazarusidestrconsts:liskmsaveas
msgid "SaveAs"
msgstr "Mentés másként"

#: lazarusidestrconsts:fdmscaleword
msgid "Scale"
msgstr "Méretarány"

#: lazarusidestrconsts:lisscalingfactor
msgid "Scaling factor:"
msgstr "Méretarány tényező:"

#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure
msgid "Scan Unit for Unit Name and Register procedure"
msgstr "Unit nach Unitname und Register-Prozedur durchKeresésn"

#: lazarusidestrconsts:liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Nach FPC-Meldungen durchKeresésn"

#: lazarusidestrconsts:liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Nach Make-Meldungen durchKeresésn"

#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr "Scannen der Ausgabe nach Free Pascal-Compilermeldungen"

#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr "Ausgabe nach Make-Meldungen durchKeresésn"

#: lazarusidestrconsts:dlgscope
msgid "Scope"
msgstr "Bereich"

#: lazarusidestrconsts:srvk_scroll
msgid "Scroll"
msgstr "Görgetés"

#: lazarusidestrconsts:dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Eine Zeile weniger scrollen"

#: lazarusidestrconsts:srkmecscrolldown
msgid "Scroll down one line"
msgstr "Görgetés egy sorral lejjebb"

#: lazarusidestrconsts:srkmecscrollleft
msgid "Scroll left one char"
msgstr "Görgetés egy karakterrel balra"

#: lazarusidestrconsts:dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Görgetés a fájl végén túlra"

#: lazarusidestrconsts:dlgscrollpastendline
msgid "Scroll past end of line"
msgstr "Görgetés a sor végén túlra"

#: lazarusidestrconsts:srkmecscrollright
msgid "Scroll right one char"
msgstr "Görgetés egy karakterrel jobbra"

#: lazarusidestrconsts:srkmecscrollup
msgid "Scroll up one line"
msgstr "Görgetés egy sorral feljebb"

#: lazarusidestrconsts:lissearchfor
msgid "Search For "
msgstr "Keresés"

#: lazarusidestrconsts:lismenuviewsearchresults
msgid "Search Results"
msgstr "Keresési találatok"

#: lazarusidestrconsts:lissearchagain
msgid "Search again"
msgstr "Újra keresés"

#: lazarusidestrconsts:lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Keresés a megjegyzésekben"

#: lazarusidestrconsts:lispatheditsearchpaths
msgid "Search paths:"
msgstr "Keresési útvonal:"

#: lazarusidestrconsts:lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Keresési feltétel '%s' nincs meg!"

#: lazarusidestrconsts:dlgsearchabort
msgid "Search terminated by user."
msgstr "Keresés felhasználó által megszakítva"

#: lazarusidestrconsts:lisssearchtext
msgid "Search text"
msgstr "Szöveg keresése"

#: lazarusidestrconsts:lisfrisearchwhere
msgid "Search where"
msgstr "Keresés ott"

#: lazarusidestrconsts:lisssearching
msgid "Searching"
msgstr "Keresés"

#: lazarusidestrconsts:dlgsearchcaption
msgid "Searching..."
msgstr "Keresés ..."

#: lazarusidestrconsts:lisuesearching
msgid "Searching: %s"
msgstr "Keresés: %s"

#: lazarusidestrconsts:lislazdocseealsotag
msgid "See also"
msgstr "Lásd"

#: lazarusidestrconsts:lisseemessages
msgid "See messages."
msgstr "Lásd az üzeneteket"

#: lazarusidestrconsts:srkmecselleft
msgid "SelLeft"
msgstr "Kijelölés balra"

#: lazarusidestrconsts:srkmecselright
msgid "SelRight"
msgstr "Kijelölés jobbra"

#: lazarusidestrconsts:lismenuselect
msgid "Select"
msgstr "Kijelölés"

#: lazarusidestrconsts:srkmecselectall
msgid "Select All"
msgstr "Minden kijelölése"

#: lazarusidestrconsts:lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Makró kód kijelölése"

#: lazarusidestrconsts:lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Delphi-Formfájl (+.dfm) kijelölése"

#: lazarusidestrconsts:srkmecseldown
msgid "Select Down"
msgstr "Kijelölés lefelé"

#: lazarusidestrconsts:srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Pozíció kijelölése"

#: lazarusidestrconsts:srkmecsellineend
msgid "Select Line End"
msgstr "Sorvége kijelölése"

#: lazarusidestrconsts:srkmecsellinestart
msgid "Select Line Start"
msgstr "Sor eleje kijelölése"

#: lazarusidestrconsts:lismenueditorselectmenu
msgid "Select Menu:"
msgstr "Menü kijelölése:"

#: lazarusidestrconsts:srkmecselpagebottom
msgid "Select Page Bottom"
msgstr "Lap alja kijelölése"

#: lazarusidestrconsts:srkmecselpagedown
msgid "Select Page Down"
msgstr "Kijelölt Seite nach unten"

#: lazarusidestrconsts:srkmecselpageleft
msgid "Select Page Left"
msgstr "Kijelölt Seite links"

#: lazarusidestrconsts:srkmecselpageright
msgid "Select Page Right"
msgstr "Kijelölt Seite rechts"

#: lazarusidestrconsts:srkmecselpagetop
msgid "Select Page Top"
msgstr "Kijelölt Seitenanfang"

#: lazarusidestrconsts:srkmecselpageup
msgid "Select Page Up"
msgstr "Kijelölt Seite hoch"

#: lazarusidestrconsts:lismenueditorselecttemplate
msgid "Select Template:"
msgstr "Minta kiválasztása:"

#: lazarusidestrconsts:srkmecselup
msgid "Select Up"
msgstr "Kijelölt nach oben"

#: lazarusidestrconsts:srkmecselwordleft
msgid "Select Word Left"
msgstr "Wort links kijelölése"

#: lazarusidestrconsts:srkmecselwordright
msgid "Select Word Right"
msgstr "Wort rechts kijelölése"

#: lazarusidestrconsts:lisselectahelpitem
msgid "Select a help item:"
msgstr "Súgó elem kijelölése"

#: lazarusidestrconsts:lisselectanode
msgid "Select a node"
msgstr "Eintrag wählen"

#: lazarusidestrconsts:lisnpselectaprojecttype
msgid "Select a project type"
msgstr "Projekt típus kiválasztása"

#: lazarusidestrconsts:lismenuselectall
msgid "Select all"
msgstr "Minden kijelölése"

#: lazarusidestrconsts:lismenuselectcodeblock
msgid "Select code block"
msgstr "Forráskódrészlet kijelölése"

#: lazarusidestrconsts:lispatheditselectdirectory
msgid "Select directory"
msgstr "Könyvtár kijelölése"

#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds
msgid "Select grand childs"
msgstr "Enkel kijelölése"

#: lazarusidestrconsts:lismenuselectline
msgid "Select line"
msgstr "Sor kijelölése"

#: lazarusidestrconsts:liskmselectlineend
msgid "Select line end"
msgstr "Sor vége kijelölése"

#: lazarusidestrconsts:liskmselectlinestart
msgid "Select line start"
msgstr "Sor eleje kijelölése"

#: lazarusidestrconsts:liskmselectpagebottom
msgid "Select page bottom"
msgstr "Lap alja kijelölése"

#: lazarusidestrconsts:liskmselectpagetop
msgid "Select page top"
msgstr "Lap teteje kijelölése"

#: lazarusidestrconsts:lismenuselectparagraph
msgid "Select paragraph"
msgstr "Szakasz kijelölése"

#: lazarusidestrconsts:lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Szülő komponens kijelölése"

#: lazarusidestrconsts:srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Kijelölés az egész elejéig"

#: lazarusidestrconsts:srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Kijelölés az egész végéig"

#: lazarusidestrconsts:lismenuselecttobrace
msgid "Select to brace"
msgstr "Bis zu Klammer"

#: lazarusidestrconsts:lismenuselectword
msgid "Select word"
msgstr "Kifejezés kijelölése"

#: lazarusidestrconsts:liskmselectwordleft
msgid "Select word left"
msgstr "Wort links wählen"

#: lazarusidestrconsts:liskmselectwordright
msgid "Select word right"
msgstr "Wort rechts wählen"

#: lazarusidestrconsts:liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Kijelölt Csomópont:"

#: lazarusidestrconsts:dlgselectedtext
msgid "Selected Text"
msgstr "Kijelölt Szöveg"

#: lazarusidestrconsts:lispckexplisrequiredby
msgid "Selected package is required by:"
msgstr "Das gewählte Package wird benötigt von:"

#: lazarusidestrconsts:dlgruberbandselectioncolor
msgid "Selection"
msgstr "Kijelölés"

#: lazarusidestrconsts:lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Kijelölt überschreitet Stringkonstante"

#: lazarusidestrconsts:lisselectiontool
msgid "Selection tool"
msgstr "Kijelölő eszköz"

#: lazarusidestrconsts:liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Pontosvessző"

#: lazarusidestrconsts:dlgposavesession
msgid "Session"
msgstr "Folyamat"

#: lazarusidestrconsts:srkmecsetmarker
msgid "Set Marker %d"
msgstr "Markierung %d setzen"

#: lazarusidestrconsts:uemsetfreebookmark
msgid "Set a free Bookmark"
msgstr "Beállítás egy szabad könyvjelzőre"

#: lazarusidestrconsts:lismenusetfreebookmark
msgid "Set a free bookmark"
msgstr "Beállítás egy szabad könyvjelzőre"

#: lazarusidestrconsts:dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Minden elem beállítása alapértelmezettnek"

#: lazarusidestrconsts:dlgsetelementdefault
msgid "Set element to default"
msgstr "Elemet alapértelmezettnek"

#: lazarusidestrconsts:liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Freies Lesezeichen setzen"

#: lazarusidestrconsts:liskmsetmarker0
msgid "Set marker 0"
msgstr "Markierung 0 setzen"

#: lazarusidestrconsts:liskmsetmarker1
msgid "Set marker 1"
msgstr "Markierung 1 setzen"

#: lazarusidestrconsts:liskmsetmarker2
msgid "Set marker 2"
msgstr "Markierung 2 setzen"

#: lazarusidestrconsts:liskmsetmarker3
msgid "Set marker 3"
msgstr "Markierung 3 setzen"

#: lazarusidestrconsts:liskmsetmarker4
msgid "Set marker 4"
msgstr "Markierung 4 setzen"

#: lazarusidestrconsts:liskmsetmarker5
msgid "Set marker 5"
msgstr "Markierung 5 setzen"

#: lazarusidestrconsts:liskmsetmarker6
msgid "Set marker 6"
msgstr "Markierung 6 setzen"

#: lazarusidestrconsts:liskmsetmarker7
msgid "Set marker 7"
msgstr "Markierung 7 setzen"

#: lazarusidestrconsts:liskmsetmarker8
msgid "Set marker 8"
msgstr "Markierung 8 setzen"

#: lazarusidestrconsts:liskmsetmarker9
msgid "Set marker 9"
msgstr "Markierung 9 setzen"

#: lazarusidestrconsts:dlgsetpropertyvariable
msgid "Set property variable"
msgstr "Változó tulajdonságok beállítása"

#: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Breakpoint trotzdem setzen"

#: lazarusidestrconsts:lislazbuildsettobuildall
msgid "Set to %sBuild All%s"
msgstr "Setzen auf %sAlles bauen%s"

#: lazarusidestrconsts:srvk_shift
msgid "Shift"
msgstr ""

#: lazarusidestrconsts:srkmecshifttab
msgid "Shift Tab"
msgstr ""

#: lazarusidestrconsts:lislazdocshorttag
msgid "Short"
msgstr "Röviden"

#: lazarusidestrconsts:lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Fájlname verkürzen oder expandieren"

#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr "Soll die Fájl in Kleinbuchstaben nach%s%s%s%sumbenannt werden?"

#: lazarusidestrconsts:lisaf2pshowall
msgid "Show All"
msgstr "Minden látszik"

#: lazarusidestrconsts:lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Anzeige der CodeTools-Werte"

#: lazarusidestrconsts:dlgcoshowerr
msgid "Show Errors"
msgstr "Hibák"

#: lazarusidestrconsts:dlgguidelines
msgid "Show Guide Lines"
msgstr "Látszik a Margó"

#: lazarusidestrconsts:dlgshowhint
msgid "Show Hints"
msgstr "Buborék ablak látszik"

#: lazarusidestrconsts:dlghintsparametersendernotused
msgid "Show Hints for parameter \"Sender\" not used"
msgstr "Hintanzeige für den Parameter \"Sender\" wird nicht verwendet"

#: lazarusidestrconsts:dlghintsunused
msgid "Show Hints for unused units in main source"
msgstr "Zeige Megjegyzése auf nicht verwendete Units im Hauptquelltext"

#: lazarusidestrconsts:uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Sorszám látszik"

#: lazarusidestrconsts:dlgshownotes
msgid "Show Notes"
msgstr "Notizen anzeigen"

#: lazarusidestrconsts:dlgcoshowoptions
msgid "Show Options"
msgstr "Einstellungen anzeigen"

#: lazarusidestrconsts:fdmshowoptions
msgid "Show Options for form editing"
msgstr "Anzeigen der Einstellungen für das Bearbeiten von Formularen"

#: lazarusidestrconsts:dlgshowwarnings
msgid "Show Warnings"
msgstr "Figyelmeztetés látszik"

#: lazarusidestrconsts:lisa2pshowall
msgid "Show all"
msgstr "Minden látszik"

#: lazarusidestrconsts:liscoshowallmessages
msgid "Show all messages"
msgstr "Minden üzenet látszik"

#: lazarusidestrconsts:dlgshowprocserror
msgid "Show all procs on error"
msgstr "Alle Prozeduren bei Fehlern anzeigen"

#: lazarusidestrconsts:dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Szegélytérköz látszik"

#: lazarusidestrconsts:dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Schließen-Button im Notebook anzeigen"

#: lazarusidestrconsts:srkmecshowcodecontext
msgid "Show code context"
msgstr "Code-Context anzeigen"

#: lazarusidestrconsts:dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Kompilierte Prozeduren anzeigen"

#: lazarusidestrconsts:dlgshowcompileroptions
msgid "Show compiler options"
msgstr "Fordító beállítás látszik"

#: lazarusidestrconsts:dlgshowcaps
msgid "Show component captions"
msgstr "Komponens név látszik"

#: lazarusidestrconsts:dlgshowconditionals
msgid "Show conditionals"
msgstr "Bedingungen anzeigen"

#: lazarusidestrconsts:dlgshowdebuginfo
msgid "Show debug info"
msgstr "Hibakereső info látszik"

#: lazarusidestrconsts:dlgshowdefinedmacros
msgid "Show defined macros"
msgstr "A definiált makrók látszanak"

#: lazarusidestrconsts:dlgshowedrhints
msgid "Show editor hints"
msgstr "Szerkesztőben buborékablak látszik"

#: lazarusidestrconsts:dlgshoweverything
msgid "Show everything"
msgstr "Minden látszik"

#: lazarusidestrconsts:dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Executable-Info anzeigen (nur für Win32)"

#: lazarusidestrconsts:dlgshowgeneralinfo
msgid "Show general info"
msgstr "Látszik az általános info"

#: lazarusidestrconsts:dlgqshowgrid
msgid "Show grid"
msgstr "Rács látszik"

#: lazarusidestrconsts:dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Leistenhineise zeigen"

#: lazarusidestrconsts:lisshowhintsinobjectinspector
msgid "Show hints in Object Inspector"
msgstr "Kiegészítés ha nem látszik a szöveg"

#: lazarusidestrconsts:dlgshowlinenumbers
msgid "Show line numbers"
msgstr "Sorszám látszik"

#: lazarusidestrconsts:lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Üzenetablak a hibakereső leállásakor"

#: lazarusidestrconsts:dlgshownothing
msgid "Show nothing (only errors)"
msgstr "nincs üzenet (csak hibák)"

#: lazarusidestrconsts:lisshowoldtaborder
msgid "Show old tab order"
msgstr "TabStop sorrend"

#: lazarusidestrconsts:dlgshowscrollhint
msgid "Show scroll hint"
msgstr "Scroll megjegyzés megjelenítés"

#: lazarusidestrconsts:dlgshowsummary
msgid "Show summary"
msgstr "Összefoglaló megtekintése"

#: lazarusidestrconsts:dlgshowtriedfiles
msgid "Show tried files"
msgstr "Megbízható fájlok megjelenítése"

#: lazarusidestrconsts:dlgshowusedfiles
msgid "Show used files"
msgstr "Felhasznált fájlok megjelenítése"

#: lazarusidestrconsts:lissibling
msgid "Sibling"
msgstr "Testvércsomópont"

#: lazarusidestrconsts:lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "jelölések"

#: lazarusidestrconsts:lissimplesyntax
msgid "Simple Syntax"
msgstr "Egyszerű szintaxis"

#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Egyszerű szintaxis (Pl. * statt .*)"

#: lazarusidestrconsts:fdmsizeword
msgid "Size"
msgstr "Méret"

#: lazarusidestrconsts:lisuidsize
msgid "Size:"
msgstr "Méret:"

#: lazarusidestrconsts:liscoskipcallingcompiler
msgid "Skip calling Compiler"
msgstr "Fordító hívás kihagyása"

#: lazarusidestrconsts:lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Fájl kihagyása és a betöltés folytatása"

#: lazarusidestrconsts:lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "Az utolsó projekt betöltésének kihagyása"

#: lazarusidestrconsts:dlgcosmaller
msgid "Smaller Code"
msgstr "Kisméretű kód"

#: lazarusidestrconsts:dlgcosmartlinkable
msgid "Smart Linkable"
msgstr "Smart-Linkbar"

#: lazarusidestrconsts:dlgsmarttabs
msgid "Smart tabs"
msgstr "Intelligentes Einrücken"

#: lazarusidestrconsts:dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Segédvonalhoz illesztés"

#: lazarusidestrconsts:dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Rácshoz illesztés"

#: lazarusidestrconsts:srvk_snapshot
msgid "Snapshot"
msgstr "Pillanatfelvétel"

#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Néhány fájl megváltozott a lemezen:"

#: lazarusidestrconsts:lissorrynotimplementedyet
msgid "Sorry, not implemented yet"
msgstr "Elnézést, ez még nem elérhető"

#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Elnézést, ez a típus még nem elérhető"

#: lazarusidestrconsts:lissortselsortselection
msgid "Sort selection"
msgstr "Kijelölés rendezése"

#: lazarusidestrconsts:lismenusortselection
msgid "Sort selection ..."
msgstr "Kijelölés rendezése ..."

#: lazarusidestrconsts:lismenuviewsourceeditor
msgid "Source Editor"
msgstr "Forráskód szerkesztő"

#: lazarusidestrconsts:srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Editorbefehle"

#: lazarusidestrconsts:lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "Forrás és cél megeggyezik:%s%s"

#: lazarusidestrconsts:lismenuaddbpsource
msgid "Source breakpoint"
msgstr "Forráskód megszakításpont"

#: lazarusidestrconsts:lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr "Forráskönyvtár %s%s%s nincs meg."

#: lazarusidestrconsts:lissourcemodified
msgid "Source modified"
msgstr "Forrás módosítva"

#: lazarusidestrconsts:lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr "Forrásfájl %s%s%s módosítva. Menti?"

#: lazarusidestrconsts:lissourcepaths
msgid "Source paths"
msgstr "Forrás könyvtár"

#: lazarusidestrconsts:lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Forráskód előnézet"

#: lazarusidestrconsts:dlgspacenotcosmos
msgid "Space"
msgstr "Szóköz"

#: lazarusidestrconsts:lisspaceequally
msgid "Space equally"
msgstr "Szóköz egyenlő"

#: lazarusidestrconsts:srvk_space
msgid "Space key"
msgstr "Szóköz billentyű"

#: lazarusidestrconsts:rslanguagespanish
msgid "Spanish"
msgstr "Spanyol"

#: lazarusidestrconsts:lisuidsrc
msgid "Src"
msgstr "Forrás"

#: lazarusidestrconsts:dlgcostack
msgid "Stack"
msgstr "Verem"

#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "Megszokott szerkesztő menü"

#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "Megszokott Fájlmenü"

#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "Megszokott súgó menü"

#: lazarusidestrconsts:lisstartwithanewproject
msgid "Start with a new project"
msgstr "Indítás egy új projekttel"

#: lazarusidestrconsts:lisoipstate
msgid "State"
msgstr "Állapot"

#: lazarusidestrconsts:dlgstatickeyword
msgid "Static Keyword in Objects"
msgstr "\"static\"-Schlüsselwort in Objekten"

#: lazarusidestrconsts:lishintstepinto
msgid "Step Into"
msgstr "Belépés"

#: lazarusidestrconsts:lishintstepover
msgid "Step Over"
msgstr "Átlépés"

#: lazarusidestrconsts:lismenustepinto
msgid "Step into"
msgstr "Belépés"

#: lazarusidestrconsts:lismenustepover
msgid "Step over"
msgstr "Átlépés"

#: lazarusidestrconsts:lismenustop
msgid "Stop"
msgstr "Állj"

#: lazarusidestrconsts:lisstopdebugging
msgid "Stop Debugging?"
msgstr "Hibakereső leállítása?"

#: lazarusidestrconsts:dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Leállási hibaszám:"

#: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Das Debugging abbrechen und das Projekt neu Létrehozás?"

#: lazarusidestrconsts:lisstopdebugging2
msgid "Stop debugging?"
msgstr "Hibakereső leállítása?"

#: lazarusidestrconsts:liskmstopprogram
msgid "Stop program"
msgstr "Program állj"

#: lazarusidestrconsts:lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Hibakereső leállítása?"

#: lazarusidestrconsts:lispckeditsetdependencydefaultfilename
msgid "Store dependency filename"
msgstr "Namen der Abhängigkeit speichern"

#: lazarusidestrconsts:dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Gespeicherte Nachsilbe"

#: lazarusidestrconsts:lisstreamingerror
msgid "Streaming error"
msgstr "Streaming-Fehler"

#: lazarusidestrconsts:liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Stringkonstante"

#: lazarusidestrconsts:lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Stringkonstanten im Quelltext"

#: lazarusidestrconsts:lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Strings mit identischen Werten:"

#: lazarusidestrconsts:dlgcostrip
msgid "Strip Symbols From Executable"
msgstr "Debuggersymbole aus der ausführbaren Fájl entfernen"

#: lazarusidestrconsts:dlgcostyle
msgid "Style:"
msgstr "Stílus:"

#: lazarusidestrconsts:lissubprocedure
msgid "Sub Procedure"
msgstr "Unterprozedur"

#: lazarusidestrconsts:lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Unterprozedur derselben Stufe"

#: lazarusidestrconsts:dlgedbsubdir
msgid "Sub directory"
msgstr "Unterverzeichnis"

#: lazarusidestrconsts:dlgsubpropkcolor
msgid "Subpropertes"
msgstr "Untergeordnete Eigenschaften"

#: lazarusidestrconsts:lissuccess
msgid "Success"
msgstr "Sikeres"

#: lazarusidestrconsts:lisa2pswitchpaths
msgid "Switch Paths"
msgstr "Pfade tauschen"

#: lazarusidestrconsts:srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Zwischen Formular und Unit umschalten"

#: lazarusidestrconsts:liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Szimbólum"

#: lazarusidestrconsts:dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Symbol dahinter (.pp~)"

#: lazarusidestrconsts:dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Symbol davor (*.~pp)"

#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
msgstr "SynEdit - die von Lazarus eingesetzte Editorkomponente. http://sf.net/projects/synedit/"

#: lazarusidestrconsts:srkmecsyntaxcheck
msgid "Syntax check"
msgstr "Szintaxis ellenőrzés"

#: lazarusidestrconsts:dlgsyntaxoptions
msgid "Syntax options"
msgstr "Szintaxis beállítások"

#: lazarusidestrconsts:dlgrunosystemvariables
msgid "System variables"
msgstr "System változók"

#: lazarusidestrconsts:dlgbp7cptb
msgid "TP/BP 7.0 Compatible"
msgstr "TP/BP 7.0-kompatibilis"

#: lazarusidestrconsts:srvk_tab
msgid "Tab"
msgstr "Tab"

#: lazarusidestrconsts:listaborderof
msgid "Tab Order of"
msgstr "Tabulátor sorrend:"

#: lazarusidestrconsts:dlgtabindent
msgid "Tab indents blocks"
msgstr "Tab rückt ganze Blöcke ein"

#: lazarusidestrconsts:fdmtaborder
msgid "Tab order..."
msgstr "Tabulátor sorrend..."

#: lazarusidestrconsts:liseotabwidths
msgid "Tab widths"
msgstr "Tabulátor távolság"

#: lazarusidestrconsts:dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Tabulatoren in Leerzeichen umwandeln"

#: lazarusidestrconsts:lismenutabstospacesselection
msgid "Tabs to spaces in selection"
msgstr ""

#: lazarusidestrconsts:listargetcpu
msgid "Target CPU"
msgstr "Célprocesszor"

#: lazarusidestrconsts:lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "Célprocesszor:"

#: lazarusidestrconsts:lislazbuildtargetdirectory
msgid "Target Directory:"
msgstr "Célkönyvtár:"

#: lazarusidestrconsts:listargetos
msgid "Target OS"
msgstr "Operációs rendszer"

#: lazarusidestrconsts:liscotargetosspecificoptions
msgid "Target OS specific options"
msgstr "Operációs rendszerfüggő beállítások"

#: lazarusidestrconsts:lislazbuildtargetos
msgid "Target OS:"
msgstr "Operációs rendszer:"

#: lazarusidestrconsts:dlgtargetplatform
msgid "Target Platform:"
msgstr "Cél Platform:"

#: lazarusidestrconsts:dlgpotargetfilename
msgid "Target file name:"
msgstr "Cél fájl név:"

#: lazarusidestrconsts:listargetfilenameplusparams
msgid "Target filename + params"
msgstr "ZielFájlname und Parameter des Projekts"

#: lazarusidestrconsts:listargetfilenameofproject
msgid "Target filename of project"
msgstr "ZielFájlname des Projekts"

#: lazarusidestrconsts:dlgtargetproc
msgid "Target i386"
msgstr "Cél i386"

#: lazarusidestrconsts:lismenueditortemplatepreview
msgid "Template Preview"
msgstr "VorlagenElőnézet"

#: lazarusidestrconsts:dlgtplfname
msgid "Template file name"
msgstr "VorlagenFájlname"

#: lazarusidestrconsts:lisctdtemplates
msgid "Templates"
msgstr "Minták"

#: lazarusidestrconsts:liscomptest
msgid "Test"
msgstr "Teszt"

#: lazarusidestrconsts:listestdirectory
msgid "Test directory"
msgstr "Teszt könyvtár"

#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Teszt könyvtár \"%s\" nincs meg."

#: lazarusidestrconsts:lispkgfiletypetext
msgid "Text"
msgstr "Text"

#: lazarusidestrconsts:dlgtextattributes
msgid "Text attributes"
msgstr "Szövegfájl attribútumok"

#: lazarusidestrconsts:srkmcatediting
msgid "Text editing commands"
msgstr "Szövegszerkesztő utasítások"

#: lazarusidestrconsts:srkmcatmarker
msgid "Text marker commands"
msgstr "Szöveg megjelölő utasítások"

#: lazarusidestrconsts:srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Szöveg kereső és áthelyező utasítások"

#: lazarusidestrconsts:srkmcatselection
msgid "Text selection commands"
msgstr "Szöveg kijelölő utasítások"

#: lazarusidestrconsts:lisfindfiletexttofind
msgid "Text to find:"
msgstr "Szövegkeresés:"

#: lazarusidestrconsts:lisdiffdlgtext1
msgid "Text1"
msgstr "Text1"

#: lazarusidestrconsts:lisdiffdlgtext2
msgid "Text2"
msgstr "Text2"

#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "Das %s Hauptverzeichnis,%sin dem Borland alle %s Quellen installiert hat,%sdie von diesem %s-Projekt verwendet werden.%sBeispielsweise: /home/user/kylix/%s"

#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Das %s Hauptverzeichnis%sin dem Borland alle %s Quellen installiert hat,%sdie von diesem Projekt verwendet werden%sBeispielsweise C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "Das %s Hauptverzeichnis%sin dem Borland alle %s Quellen installiert hat,%s.Beispielsweise /home/user/kylix%s"

#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Das %s Hauptverzeichnis%sin dem Borland alle %s Quellen installiert hat,%s.Beispielsweise C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "Das %s Projektverzeichnis,%sdas die .dpr- und dpk-Fájl enthält."

#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
msgstr "Die FCL (Free Pascal Component Library) enthält die Basisklassen für Object Pascal."

#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
msgstr "Das FPC-Quellverzeichnis \"%s\" sieht falsch aus. Es sollte Verzeichnisse wie rtl, packages, compiler usw. enthalten ..."

#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "Das Free-Pascal-SVN-Quellverzeichnis"

#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgstr "Das Free-Pascal-SVN-Quellverzeichnis. Nicht unbedingt benötigt. Diese Angaben verbessert das Finden von Deklarationen und das Debugging."

#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
msgstr "Der Free Pascal-Compiler (Fájlname: %s) wurde nincs meg.%sEs wird empfohlen, FPC zu installieren."

#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Das Free-Pascal-Projektverzeichnis"

#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
msgstr "Das Free-Pascal-Quelltextverzeichnis wurde nincs meg.%sEinige Quelltextfunktionen werden nicht funktionieren.%sEs wird empfohlen, dass Sie den FPC-Quelltext installieren und den Pfad auf sie setzen, und zwar unter%sEinstellungen->Umgebungseinstellungen->Fájlen"

#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
msgstr "Die LCL (\" Lazarus Component Library\") enthält alle Basiskomponten um Formulare zu bearbeiten."

#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgstr "Die LFM-Fájl (Lazarus Form) enthält ungültige Eigenschaften. Das bedeutet beispielsweise, daß einige Eigenschaften/Klassen nicht in der aktuellen LCL enthalten sind. Das wird normalerweise behoben, indem diese Eigenschaften aus der LFM-Fájl entfernt und der Pascal-Quelltext manuell korrigiert wird."

#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlz check Environment -> Environment Options -> Files"
msgstr "Das Lazarus-Verzeichnis wurde nincs meg.%sSie werden keine LCL-Programme Létrehozás können.%sBitte überprüfen Sie Einstellungen->Umgebungseinstellungen->Fájlen"

#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory
msgid "The Lazarus main directory."
msgstr "Das Lazarus-Hauptverzeichnis"

#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Die Maximalversionsangabe %s%s%s ist ungültig.%sBitte verwenden Sie das Format Major.Minor.Release.Build%sBeispielsweise: 1.0.20.10"

#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Die maximal benötigte Version ist kleiner als die minimale."

#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Die Minimalversionsangabe %s%s%s ist ungültig.%sBitte verwenden Sie das Format Major.Minor.Release.Build%sBeispielsweise: 1.0.20.10"

#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
msgstr "Die RTL - Die Laufzeitumgebung ist die Basis aller Free-Pascal-Programme."

#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
msgstr "Das Testverzeichnis wurde nincs meg:%s%s%s%s%s(siehe Umgebungseinstellungen)"

#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Die Basisklasse %s%s%s besitzt den selben Namen wie%sdie Unit %s%s%s."

#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgstr "Die Basisklassenname %s%s%sist kein gültiger Pascal-Bezeichner."

#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgstr "Die Klasse %s%s%s ist ein TControl und kann nicht auf ein Nicht-Control gepastet werden.%sKann Paste nicht durchführen."

#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr "Der Klassenname %s%s%s und der Basisklassenname %s%s%s sind gleich."

#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr "Der Klassenname %s%s%s tritt bereits im%sPackage %s%s auf. Fájl %s%s%s"

#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Der Klassename %s%s%s ist identisch zu dem%sder Unit%s%s%s."

#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name %s%s%s is not a valid pascal identifier."
msgstr "Der Klassenname %s%s%s ist kein gültiger Pascalbezeichner."

#: lazarusidestrconsts:listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr "Der Befehl nach %s%s%s ist nicht ausführbar."

#: lazarusidestrconsts:listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr "Der nach dem Veröffentlichen auszuführende Befehl ungültig:%s%s%s%s"

#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg
msgid "The compiler file \"%s\" is not an executable."
msgstr "Die CompilerFájl \"%s\" ist nicht ausführbar."

#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "Die CompilerFájl des Packages %s ist keine gültige ausführbare Fájl:%s%s"

#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr "Der Komponenteneditor der Klasse %s%s%s%s, aufgerufen mit dem Verb #%s %s%s%s%s hat dem folgenden Fehler erzeugt:%s%s%s%s"

#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%shas created the error:%s%s%s%s"
msgstr "Der Komponteneditor der Klasse %s%s%shat den folgenden Fehler erzeugt:%s%s%s%s"

#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
msgstr "Das aktuelle Free Pascal-Quelltextverzeichnis %s%s%s%sieht nicht richtig aus.%sÜberprüfen Sie Einstellungen->Umgebungseinstellungen->Fájlen"

#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Das aktuelle Free Pascal-Quelltextverzeichnis %s%s%s%sieht nicht richtig aus.%sMit \"OK\" wählen Sie die Voreinstellung %s%s%s.%sSonst überprüfen Sie Einstellungen->Umgebungseinstellungen->Fájlen"

#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
msgstr "Das aktuelle Lazarus-Verzeichnis %s%s%s%ssieht nicht korrekt aus.%sOhne es können keine LCL-Programme geschrieben werden.%sÜberprüfen Sie Einstellungen->Umgebungseinstellungen->Fájlen"

#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Das aktuelle Lazarus-Verzeichnis %s%s%s%ssieht nicht richtig aus.%sOhne es können keine LCL-Programme geschrieben werden.%sMit \"OK\" setzen Sie die Voreinstellung %s%s%s.%sSonst Überprüfen Sie Einstellungen->Umgebungseinstellungen->Fájlen"

#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Der aktuelle CompilerFájlname %s%s%s%sist keine gültige ausführbare Fájl.%sDrücken Sie \"Ok\" um die Voreinstellung %s%s%szu verwenden .%sSonst überprüfen Sie Einstellungen->Umgebungseinstellungen->Fájlen"

#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplz
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlz check Environment -> Environment Options -> Files"
msgstr "Der aktuelle CompilerFájlname %s%s%s%sist keine gültige ausführbare Fájl.%sBitte überprüfen Sie Einstellungen->Umgebungseinstellungen->Fájlen"

#: lazarusidestrconsts:lisuethecurre
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgstr "Die aktuelle Editorschriftart unterstützt UTF-8 nicht aber das System scheint das zu tun.%sDas bedeutet, daß Nicht-ASCII-Zeichen möglicherweise falsch angezeigt werden.%In den Editoroptionen können Sie eine andere Schriftart einstellen."

#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
msgstr "Der aktuelle Unitpfad der Fájl %s%s%s%sist%s%s%s%s.%s%s Der Pfad zu den LCL-Units %s%s%s fehlt.%s%sMegjegyzés für Einsteiger:%sLétrehozás Sie eine Lazarus-Applikation und legen Sie die Fájl ins Projektverzeichnis."

#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
msgstr "Der Debugger %s%s%s%sfehlt oder ist nicht ausführbar.%s%sSiehe: Umgebung -> Debugger-Optionen"

#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "Die Debugger-Fájl \"%s\" ist nicht ausführbar."

#: lazarusidestrconsts:lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr "Die Abhängigkeit %s%s%s wurde nincs meg.%sBitte wählen Sie ein vorhandenes Package."

#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr "Das Zielverzeichnis%s%s%s%s ist nicht vorhanden."

#: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgstr "Das Verzeichnis %s%s%s wird nicht länger im Unit-Pfad benötigt.%sEntfernen?"

#: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgstr "A könyvtár %s%s%s még nem szerepel a unit útvonalban.%sHozzáadja?"

#: lazarusidestrconsts:dlgthedirectory
msgid "The directory \""
msgstr "A könyvtár \""

#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing lazarus Project."
msgstr "Die Fájl %s scheint die ProgrammFájl eines vorhandenen Lazarus-Projekts zu sein"

#: lazarusidestrconsts:listhefile
msgid "The file %s%s%s"
msgstr "A Fájl %s%s%s"

#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage
msgid "The file %s%s%s is already in the package."
msgstr "Ez a fájl %s%s%s már létezik a csomagban."

#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr
msgid "The file %s%s%s is not a Delphi project (.dpr)"
msgstr "A fájl  %s%s%s nem Delphi projekt (.dpr)"

#: lazarusidestrconsts:listhefileisnotadelphiunit
msgid "The file %s%s%s is not a Delphi unit."
msgstr "A fájl %s%s%s nem Delphi Unit"

#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage
msgid "The file %s%s%s is not a lazarus package."
msgstr "A fájl %s%s%s nem Lazarus csomag."

#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Die Fájl %s%s%s ist Teil des aktuellen Projekts.%sEs ist keine gute Idee, Fájlen zwischen Projekten und Packages auszutauschen."

#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage
msgid "The file %s%s%s%sis already in the package %s."
msgstr "A fájl %s%s%s%s már szerepel a %s csomagban."

#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
msgstr "Die Fájl %s%s%s%sbefindet sich derzeit nicht im Unitpfad des Packages.%s%s. %s%s%s in den Unitpfad aufnehmen?"

#: lazarusidestrconsts:lispkgmangthefileofpackageismissing
msgid "The file %s%s%s%sof package %s is missing."
msgstr "Die Fájl %s%s%s%sdes Packages %s fehlt."

#: lazarusidestrconsts:lispkgmangthefileofpackageneedstobesavedfirst
msgid "The file %s%s%s%sof package %s needs to be saved first."
msgstr "Die Fájl %s%s%s%sdes packages %s muß zuerst gespeichert werden"

#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "Die Fájl %s%s%s%sscheint ein Programm zu sein. Aktuelle Projekt schließen ein Újs Lazarus-Projekt für dieses Programm Létrehozás?%s'Nein' lädt die Fájl als normalen Quelltext."

#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr "Die Fájl %s%s%s%swurde in einem der Quelltextverzeichnisse des Packages %s gefunden und sieht wie ein kompilierte Unit aus. Kompilierte Units müssen sich im Ausgabeverzeichnis des Packages befinden, sonst können andere Packages Probleme bekommen, die dieses Package verwenden.%s%s.Zweifelhafte Fájl löschen?"

#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr "Die Fájl %s%s%s%swurde nincs meg.%sWollen Sie selbst nach ihr Keresésn?%s"

#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort  will stop the loading."
msgstr "Die Fájl %s%s%s%swurde nincs meg.%s \"Übergehen\" lädt das Projekt weiter,%s\"Abbruch\" stoppt das Laden."

#: lazarusidestrconsts:uefilerotext1
msgid "The file \""
msgstr "A fájl \""

#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr "Der Fájlname %s%s%s ist Teil des aktuellen Projekts.%sProjekte und Packages sollten keine gemeinsamen Fájlen haben."

#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr "Der Fájlname %s%s%s wird von%sdem Package %s%s%s%sin der Fájl %s%s%s genutzt."

#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr "Der Fájlname %s%s%s stimmte nicht dem Csomag Namen %s%s%s in der Fájl überein.%sSoll der Name des Packages auf %s%s%s geändert werden?"

#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "Der Fájlname %s%s%s ist unklar, da für das Package noch kein Verzeichnis voreingestellt istt.%sBitte geben Sie den kompletten Pfad zum Fájlnamen mit an.."

#: lazarusidestrconsts:listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgstr "Die folgenden Methoden, die von %s verwendet werden sind nicht im Quelltext%s%s%s%s%s%sDie hängenden Verweise löschen?"

#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Das folgende Package konnte nicht geladen werden:"

#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Die folgenden Packages konnte nicht geladen werden:"

#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren
msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out."
msgstr "Die folgenden Units wurden nincs meg: %s%s%s%s1) Entweder sind sie nicht im Unit-Pfad, dann können Sie jetzt abbrechen, den Unit-Pfad korrigieren und es erneut verKeresésn.%s2)Oder sie können die fehlenden Units ignorieren und sie auskommentieren."

#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr "Die Hostapplikation %s%s%s ist nicht ausführbar"

#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr "Das ausführende Programm %s%s%s%sist nicht vorhanden oder nicht ausführbar.%s%sSiehe Start -> Startparameter -> Lokal"

#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
msgstr "Das Lazarus-Verzeichnis \"%s\" sieht nicht richtig aus. Normalerweise enthält es Verzeichnisse wie lcl, debugger, designer, components, ... ."

#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg
msgid "The make file \"%s\" is not an executable."
msgstr "Die Make-Fájl \"%s\" ist nicht ausführbar."

#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Die maximale Version %s%s%s ist keine gültige Csomag Versionsangabe.%s(Ein gutes Beispiel wäre 1.2.3.4)"

#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Die minimale Version %s%s%s ist keine gültige Csomag Versionsangabe.%s(Ein gutes Beispiel wäre 1.2.3.4)"

#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier
msgid "The name %s%s%s is not a valid pascal identifier."
msgstr "Der Name %s%s%s ist kein gültiger Pascalbezeichner."

#: lazarusidestrconsts:lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid pascal identifier."
msgstr "A név \"%s\" nem érvényes pascal azonosító."

#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgstr "Das Package %s ist ein Nur-Laufzeit-Package.%sLaufzeit-Packages können nicht in die IDE installiert werden."

#: lazarusidestrconsts:lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "A csomag %s csak olvasható."

#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "Das Package %s wird von %s benötigt, das für Installation vermerkt ist.%Lásd a csomag figyelőt."

#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
msgstr "Das Package %s besitzt die Fájl%s%s%s%s.%sSoll die Fájl im Package ebenfalls umbenannt werden?"

#: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgstr "Das Package %s%s%s konnte nicht kompiliert werden.%sAus der Installationsliste nehmen?"

#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr "Das Package %s%s%s besitzt die Kennung für automatische Installation.%sDas bedeutet, es wird in die IDE installiert. Installationspakete%smüssen Packages für die Designzeit sein."

#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "Das Package %s%s%s ist installiert, es gibt aber keine gültige Csomag Fájl (.lpk).%sEs wurde ein defektes Dummy-Package erzeugt."

#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgstr "Das Package %s%s%s ist für die Installation vermerkt, kann aber nincs meg werden.%sSoll die Abhängigkeit von der Installationsliste der Packages entfernt werden?"

#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Das Package %s%s%s war für die Installation markiert.%sDerzeit unterstützt Lazarus nur statisch gelinkte Packages. Die echte Installation verlangt eine Újrstellung und Neustart von Lazarus.%s%sWollen Sie Lazarus jetzt neu erstellen?"

#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Das Package %s%s%s war markiert.%sDerzeit unterstützt Lazarus nur statisch gelinkte Packages. Eine echte Deinstallation verlangt die Újrstellung und Neustart von Lazarus.%s%sWollen Sie Lazarus jetzt neu erstellen?"

#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgstr "Der Csomag Fájlname %s%s%s in%s%s%s%s ist kein gültiger Lazarus-Csomag Name."

#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe
msgid "The package has already a dependency for the package %s%s%s."
msgstr "Das Package besitzt bereits eine Abhängigkeit auf %s%s%s."

#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr "Der Csomag Name %s%s%s ist ungültig.%sBitte wählen Sie ein vorhandenes Package."

#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr "Der Csomag Name %s%s%s ist ungültig.%sBitte wählen Sie ein vorhandenes Package."

#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Der Packagename %s%s%s ist kein gültiger Packagename%sBitte wählen Sie einen anderen (z.B. package1.lpk)"

#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr "Der Packagename %s%s%s der%sFájl %s%s%s ist ungültig."

#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr "Der Name %s%s%s des Reiters ist zu lang (max. 100 Zeichen)."

#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "Der Pfad zum Free-Pascal-Compiler für dieses Projekt. Nur benötigt, wenn unten die FPC-SVN-Quelle gesetzt ist. Wird verwendet, um Makros automatisch zu Létrehozás."

#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Der Pfad zum Free Pascal-Compiler.%s Zum Beispiel %s/usr/bin/%s -n%s/usr/local/bin/fpc @/etc/fpc.cfg%s."

#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgstr "Das Programm %smake%s wurde nincs meg.%sEs wird für die Erstellung von Lazarus benötigt.%s"

#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr "Das Projekt besitzt bereits eine Abhängigkeit auf das Package %s%s%s."

#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr "Die Projekt-InfoFájl %s%s%s%sist identisch zur Haupt-QuelltextFájl des Projekts!"

#: lazarusidestrconsts:listheprojectisclosedtherearenowthreepossibilitieshin
msgid "The project is closed. There are now three possibilities.%sHint: You do not need to close a project yourself, since this is done automatically."
msgstr "Das Projekt ist geschlossen. Sie haben jetzt drei Möglichkeiten.%sÜbrigens: Sie brauchen ein Projekt nicht explizit schließen, das wird automatisch gemacht."

#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Das Projekt muß vor der Erstellung gesichert werden.%sWenn Sie das Testverzeichnis in den Umgebungseinstellungen setzen,%können Sie Új Projekte Létrehozás und sofort erstellen.%sProjekt speichern?"

#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr "Das Projekt benötigt das Package %s%s%s.%sEs wurde aber nincs meg. Siehe Projekt->Projekinspektor."

#: lazarusidestrconsts:listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgstr ""

#: lazarusidestrconsts:lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "Der Ressourcenstring %s%s%s ist bereits angelegt.%sBitte wählen Sie einen anderen Namen.%sDrücken Sie 'Ignorieren' um ihn trotzdem zuzufügen."

#: lazarusidestrconsts:listherootcomponentcannotbedeleted
msgid "The root component can not be deleted."
msgstr "Az alapkomponens nem törölhető."

#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
msgstr "Die Unit %s%s%s ist bereits vorhanden.%s\"Ignorieren\" wird ein Umbenennen erzwingen,%s\"Abbrechen\" wird das Speichern dieses Quelltext abbrechen%und den gesamten Speichervorgang unterbinden."

#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds
msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?"
msgstr "Die Unit %S%s%s ist nicht in Kleinbuchstaben.%sDer Free Pascal-Compiler 1.0.x benötigt Fájlnamen in Kleinbuchstaben. Wenn Sie nicht FPC 1.0.x verwenden wollen, um die Unit zu kompilieren, können Sie diese Meldung ignorieren.%s%sSoll die Fájl umbenannt werden?"

#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr "Die Unit selbst hat schon den Namen %s%s%s. Pascal-Bezeichner müssen einzigartig sein."

#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr "Der Unitname %s%s%s ist bereits im Projekt%s mit der Fájl: %s%s%s enthalten."

#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr "Der Unitname %s%s%s ist bereits der Kijelölt%s mit der Fájl: %s%s%s enthalten."

#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr "Der Unitname %s%s%s korrespondiert nicht mit dem Fájlnamen."

#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name %s%s%s is not a valid pascal identifier."
msgstr "Der Unitname %s%s%s ist kein gültiger Pascal-Bezeichner"

#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgstr "Der Unitname %s%s%s ist gleich wie eine registrierte Komponente.%sSeine Verwendung kann zu heftigen Fehlermeldungen führen."

#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgstr "Der Unitname %s%s%s%sund der Fájlname %s%s%s unterscheiden sich."

#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr "Den Unitnamen %s%s%s gibt es bereits im Package:%s%s"

#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr "Der Unitname %s%s%s ist bereits in diesem Package angelegt."

#: lazarusidestrconsts:lispvutheunitnameisnotavalidpascalidentifier
msgid "The unitname is not a valid pascal identifier."
msgstr "Der Unitname ist kein gültiger Pascal-Bezeichner."

#: lazarusidestrconsts:lispvutheunitnameisusedwhentheideextendsusesclauses
msgid "The unitname is used when the IDE extends uses clauses."
msgstr "Der Unitname wird beim Erweitern der Uses-Klausel von der IDE verwendet."

#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "Das Popup-Menü enthält mehr Funktionen"

#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "Das Verzeichnis enthält andere Fájlen mit demselben Namen,%sdie sich nur in der Schreibung unterscheiden:%s%s%sSoll diese gelöscht werden?"

#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr "Es gibt zwei Units mit demselben Namen:%s%s1. %s%s%s von %s%s2. %s%s%s von %s%s%s"

#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr "Es gibt eine FPC-Unit mit gleichem Namen wie ein Package:%s%s%s%s%s%s"

#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr "Es gibt eine FPC-Unit mit dem selben Namen wie:%s%s%s%s%s aus %s%s%s "

#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages
msgid "There is a circle in the required packages. See package graph."
msgstr "Es ist ein Ring in den benötigten Packages. Lásd a csomag figyelőt."

#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr "Es gibt eine Fájl mit dem gleichen Namen und einer ähnlichen Endung auf dem Datenträger%sVorhandene Fájl: %s%sÚj Fájl: %s%s%sProblematische Fájl löschen?"

#: lazarusidestrconsts:lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "Es gibt ein oberes Limit von %s Werkzeugen."

#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectplzchoose
msgid "There is a unit with the name %s%s%s in the project.%sPlz choose a different name"
msgstr "Es gibt eine Unit mit dem Namen %s%s%s im Projekt.%sBitte wählen Sie einen anderen Namen"

#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr "Es gibt bereits eine Unit mit dem gleichen Namen wie ein Package:%s%s1. %s%s%s aus %s%s2. %s%s%s%s"

#: lazarusidestrconsts:listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr "Es gibt schon ein Formular mit dem Namen %s%s%s"

#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgstr "Es ist bereits ein Package %s%s%s aus der Fájl %s%s%s geladen.%sSiehe Komponenten->Csomag Graph.%sErsetzen ist nicht möglich."

#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr "Es gibt bereits eine Unit mit dem Namen %s%s%s. Pascal-Bezeichner müssen einzigartig sein."

#: lazarusidestrconsts:lispvuthereisalreadyanunitwiththisnamefile
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Es gibt bereits eine Unit mit dem Namen. %sFájl: %s"

#: lazarusidestrconsts:lisdesthereisalreadyanothercomponentwiththename
msgid "There is already another component with the name %s%s%s."
msgstr "Es gibt schon eine andere Komponente mit dem Namen %s%s%s."

#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr "Es gibt bereits ein Package mit dem Namen %s%s%s.%sCsomag Konflikt: %s%s%s%sFájl: %s%s%s"

#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Das benötigte Package enthält ein ungesichertes Package. Siehe Csomag Graph."

#: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgstr "Es ist kein Debugger angegeben.%sDas Setzen von Haltepunkten ist wirklungslos solange nicht im Debugger-Optionendialog im Menü ein Debugger festgelegt ist."

#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Beim Schreiben der gewählten Komponte %s trat ein Fehler auf:%s:%s%s"

#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Beim Konvertieren des binären Streams der gewählten Komponente %s trat ein Fehler auf:%s:%s%s"

#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Beim Kopieren des Komponentenstroms in die Zwischenablage trat ein Fehler auf:%s%s"

#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Die Fájl gibt es ist in keinem der geladenen Packages."

#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
msgid "This file was automatically created by Lazarus. Do not edit!"
msgstr "Diese Fájl wurde automatisch von Lazarus erzeugt. Sie darf nicht bearbeitet werden!"

#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Das ist ein virtuelles Packages. Es besitzt, solange es noch nicht gespeichert wurde, keinen Quelltext. Bitte speichern Sie es zuerst."

#: lazarusidestrconsts:lisresourcefilecomment
msgid "This is an automatically generated lazarus resource file"
msgstr "Das ist eine automatisch erzeugte Lazarus-RessourcenFájl"

#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "Das ist das Standard-Package nur für Komponenten ohne Package. Solche Komponenten sind veraltet."

#: lazarusidestrconsts:lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr "Das ist das Geschwistercontrol an das die Unterseite verankert wurde. Für den Parent leerlassen."

#: lazarusidestrconsts:lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr "Das ist das Geschwistercontrol an das die linke Seite verankert wurde. Für den Parent leerlassen."

#: lazarusidestrconsts:lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr "Das ist das Geschwistercontrol an das die rechte Seite verankert wurde. Für den Parent leerlassen."

#: lazarusidestrconsts:listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr "Das ist das Geschwistercontrol an das die Oberseite verankert wurde. Für den Parent leerlassen."

#: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Das sieht wie eine Pascal-Fájl aus.%sEs wird empfohlen, Fájlnamen in Kleinbuchstaben anzugeben um diverse Probleme auf einige Fájlsystemen und mit verschiedenen Compilern aus dem Weg zu gehen.%sIn Kleinbuchstaben umbenennen?"

#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "Dieses Package ist installiert, aber die lpk-Fájl wurde nincs meg. Alle enthaltenen Komponenten sind abgeschaltet. Bitte beheben Sie den Fehler."

#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage
msgid "This source is only used to compile and install the package."
msgstr "Dieser Quelltext dient nur dem Übersetzen und Installieren des Packages."

#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Diese Anweisung kann nicht extrahiert werden.%sBitte wählen Sie etwas Code, um eine Új Prozedur/Methode zu extrahieren."

#: lazarusidestrconsts:lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Szál"

#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Titel und Fájlname benötigt"

#: lazarusidestrconsts:dlgpotitle
msgid "Title:"
msgstr "Cím:"

#: lazarusidestrconsts:listodolistcaption
msgid "ToDo List"
msgstr "ToDo-Lista"

#: lazarusidestrconsts:listodolistoptions
msgid "ToDo options..."
msgstr "ToDo Beállítások ..."

#: lazarusidestrconsts:lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Form/Unit nézetváltás"

#: lazarusidestrconsts:srkmectogglemode
msgid "Toggle Mode"
msgstr "Mód váltás"

#: lazarusidestrconsts:liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Váltás Unit és Form között"

#: lazarusidestrconsts:lismenuviewtoggleformunit
msgid "Toggle form/unit view"
msgstr "Form/Unit nézetváltás"

#: lazarusidestrconsts:liskmtoggleviewbreakpoints
msgid "Toggle view Breakpoints"
msgstr "Nézetváltás Megszakítási pontokra"

#: lazarusidestrconsts:liskmtoggleviewcallstack
msgid "Toggle view Call Stack"
msgstr "Nézetváltás Hívási veremre"

#: lazarusidestrconsts:liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Nézetváltás Kód intézőre"

#: lazarusidestrconsts:liskmtoggleviewdebuggeroutput
msgid "Toggle view Debugger Output"
msgstr "Nézetváltás Hibakereső kimenetre"

#: lazarusidestrconsts:liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Nézetváltás Dokumentáció szerkesztőre"

#: lazarusidestrconsts:liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Nézetváltás IDE gyors gombokra"

#: lazarusidestrconsts:liskmtoggleviewlocalvariables
msgid "Toggle view Local variables"
msgstr "Nézetváltás helyi változókra"

#: lazarusidestrconsts:liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Nézetváltás Üzenetekre"

#: lazarusidestrconsts:liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Nézetváltás Objektum felügyelőre"

#: lazarusidestrconsts:liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Nézetváltás keresési eredményekre"

#: lazarusidestrconsts:liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Nézetváltás forráskód szerkesztőre"

#: lazarusidestrconsts:liskmtoggleviewwatches
msgid "Toggle view Watches"
msgstr "Nézetváltás Változó figyelőre"

#: lazarusidestrconsts:liskmtoggleviewcomponentpalette
msgid "Toggle view component palette"
msgstr "Nézetváltás Komponens palettára"

#: lazarusidestrconsts:liscodetempltoken
msgid "Token:"
msgstr "Szimbólum:"

#: lazarusidestrconsts:lisctdefstools
msgid "Tools"
msgstr "Eszközök"

#: lazarusidestrconsts:srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Eszközök menü parancsok"

#: lazarusidestrconsts:dlgtooltipeval
msgid "Tooltip expression evaluation"
msgstr "Eszközleírás kifejezéskiértékelés"

#: lazarusidestrconsts:dlgtooltiptools
msgid "Tooltip symbol Tools"
msgstr "Tooltip-Symbol-Werkzeuge"

#: lazarusidestrconsts:listopanchoring
msgid "Top anchoring"
msgstr "Felső horgony"

#: lazarusidestrconsts:listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Felső szegélytérköz. Ez az érték hozzáadódik az alap szegélytérközhöz, és a vezérlő fölé kerül."

#: lazarusidestrconsts:listopspaceequally
msgid "Top space equally"
msgstr "Felső terület megeggyezik"

#: lazarusidestrconsts:dlgtoppos
msgid "Top:"
msgstr "Felül:"

#: lazarusidestrconsts:listops
msgid "Tops"
msgstr "Teteje"

#: lazarusidestrconsts:dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Zurechtschneiden überflüssiger Leerzeichen"

#: lazarusidestrconsts:lismenutemplatetutorial
msgid "Tutorial"
msgstr "Oktatás"

#: lazarusidestrconsts:dlgenvtype
msgid "Type"
msgstr "Típus"

#: lazarusidestrconsts:lisuidtype
msgid "Type:"
msgstr "Típus:"

#: lazarusidestrconsts:dlgcdtuppercase
msgid "UPPERCASE"
msgstr "NAGYBETŰ"

#: lazarusidestrconsts:rslanguageukrainian
msgid "Ukrainian"
msgstr "Ukrán"

#: lazarusidestrconsts:lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Bináris adatfolyam nem konvertálható szövegre"

#: lazarusidestrconsts:lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Komponens nem másolható vágólapra"

#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "Kann %s nicht zum Projekt hinzufügen. Das Projekt enthält bereits eine Unit mit dem gleichen Namen."

#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Kann die Ressource T%s nicht beillesztés:FORMDATA zur RessourcenFájl %s%s%s%s.%sMöglicherweise ein Syntaxfehler."

#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Kann den den Ressoucen-Header-Kommentar nicht zu der RessourcenFájl %s%s%s%s hinzufügen.%sMöglicherweise ein Syntaxfehler."

#: lazarusidestrconsts:lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr "Kann Fájl %s%s%s nicht nach %s%s%s speichern!"

#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlz fix errors first."
msgstr "Kann die Formularliste für automatische Erzeugung im Programmquelltext nicht ändern.%sBitte korrigieren Sie zuerst die Fehler"

#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr "Kann %s%s%s nicht aufräumen.%sÜberprüfen Sie die Fájlrechte."

#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Kann Zielverzeichnis nicht aufräumen"

#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Kann Komponententext nicht ins Binärformat umwandeln:%s%s"

#: lazarusidestrconsts:lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr "Kann Fájl %s%s%snicht konvertieren%sFehler: %s"

#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile
msgid "Unable to convert lfm to lrs and write lrs file."
msgstr "Kann lfm nicht in lrs konvertieren und lrs-Fájl nicht schreiben."

#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr "Kann die konvertierten Textformulardaten der Fájl %s%s%s%s%snicht in einen Binärstream umwandeln. (%s)"

#: lazarusidestrconsts:lisunabletocopyfile
msgid "Unable to copy file"
msgstr "A fájl nem másolható"

#: lazarusidestrconsts:lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr "Kann Fájl %s%s%s%s nicht nach %s%s%s kopieren"

#: lazarusidestrconsts:lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr "Kann Fájl %s%s%s%s nicht nach %s%s%s kopieren."

#: lazarusidestrconsts:lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr "Kann Backup-Verzeichnis %s%s%s nicht anlegen."

#: lazarusidestrconsts:lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Unfähig, das Verzeichnis anzulegen"

#: lazarusidestrconsts:lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr "Kann Verzeichnis %s%s%s nicht Létrehozás"

#: lazarusidestrconsts:lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr "Kann Verzeichnis %s%s%s nicht Létrehozás."

#: lazarusidestrconsts:lisunabletocreatefile
msgid "Unable to create file"
msgstr "A fájl nem hozható létre"

#: lazarusidestrconsts:lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr "A fájl %s%s%s nem hozható létre"

#: lazarusidestrconsts:lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr "A fájl %s%s%s nem hozható létre."

#: lazarusidestrconsts:lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr "A fájl %s%s%s nem hozható létre"

#: lazarusidestrconsts:lisunabletocreatenewmethodplzfixtheerrorshownin
msgid "Unable to create new method. Plz fix the error shown in the message window."
msgstr "Kann Új Methode nicht Létrehozás. Bitte beheben Sie dem im Meldungsfehler gezeigten Fehler."

#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr "Kann Ausgabeverzeichnis %s%s%s%sfür das Package %s nicht Létrehozás."

#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr "Kann das Csomag Quelltextverzeichnis %s%s%s%s für das Package %s nicht Létrehozás."

#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgstr "Kann kein Zielverzeichnis für Lazarus Létrehozás:%s%s%s%s.%sDieses Verzeichnis wird für die gerade geänderte Lazarus-IDE und ihre benutzerdefinierten Packages benötigt."

#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Temporärer lfm-Puffer kann nicht erzeugt werden."

#: lazarusidestrconsts:lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr "Kann die unklare Fájl %s%s%s nicht löschen"

#: lazarusidestrconsts:lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "A fájl nem törölhető"

#: lazarusidestrconsts:lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr "A fájl %s%s%s nem törölhető."

#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr "Die alte StatusFájl %s%s%s%sdes Packages %s konnte nicht gelöscht werden."

#: lazarusidestrconsts:lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "Kann %s nicht im lfm-Stream finden."

#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Kann keinen ResourceString-Abschnitt in dieser oder einer anderen eingebundenen Unit finden."

#: lazarusidestrconsts:lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr "Es konnte kein gültiger Klassenname in %s%s%s gefunden werden."

#: lazarusidestrconsts:lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr "Fájl %s%s%s konnte nincs meg werden."

#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file %s%s%s.%sCheck search path in%sProject->Compiler Options...->Search Paths->Other Unit Files"
msgstr "Die Fájl %s%s%s konnte nincs meg werden.%sÜberprüfen Sie den Suchpfad in %sProjekt->Compilereinstellungen...->Suchpfade->Andere UnitFájlen"

#: lazarusidestrconsts:lisunabletofindmethodplzfixtheerrorshowninthemessage
msgid "Unable to find method. Plz fix the error shown in the message window."
msgstr "Die Methode konnte nincs meg werden. Bitte beheben Sie dem Meldungsfenster gezeigten Fehler."

#: lazarusidestrconsts:lisunabletofindtheunitofcomponentclass
msgid "Unable to find the unit of component class %s%s%s."
msgstr "Kann die Unit der Komponentenklasse %s%s%s nicht finden."

#: lazarusidestrconsts:lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Kann Editoränderungen nicht sammeln."

#: lazarusidestrconsts:lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Quelltexte des Designers können nicht geholt werden."

#: lazarusidestrconsts:lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Die Fájl konnte nicht geladen werden"

#: lazarusidestrconsts:lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr "Die Fájl %s%s%s konnte nicht geladen werden."

#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
msgstr "Die alte RessourcenFájl konnte nicht geladen werden.%sDie RessourcenFájl ist die erste Include-Fájl im%sInitialisierungsabschnitt.%sZum Beispiel {$I %s.lrs}.%sMögliche Ursache ist ein Syntaxfehler."

#: lazarusidestrconsts:lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "Das Package konnte nicht geladen werden"

#: lazarusidestrconsts:lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgstr "Kann die Komponentenklasse %s%s%s nicht laden, da sie von sich selbst abhängt."

#: lazarusidestrconsts:lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Designer kann nicht geöffnet werden.%sDie Klasse %s stammt nicht von einer design-fähigen Klasse wie TForm oder TDataModule ab."

#: lazarusidestrconsts:lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr "Das Package %s%s%s.%s kann nicht geöffnet werden. Es war zur Installation vermerkt."

#: lazarusidestrconsts:lisunabletoreadfile
msgid "Unable to read file"
msgstr "Die Fájl konnte nicht gelesen werden"

#: lazarusidestrconsts:lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr "Die Fájl %s%s%s konnte nicht gelesen werden."

#: lazarusidestrconsts:lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr "Die Fájl %s%s%s konnte nicht gelesen werden.%sFehler: %s"

#: lazarusidestrconsts:lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr "Die Fájl %s%s%s konnte nicht gelesen werden."

#: lazarusidestrconsts:lispkgunabletoreadpackagefileerror
msgid "Unable to read package file %s%s%s.%sError: %s"
msgstr "Kann Csomag Fájl %s%s%s nicht lesen.%sFehler: %s"

#: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "Kann StatusFájl %s des Projekts %s nicht lesen%sFehler: %s"

#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr "Die StatusFájl %s%s%s%sdes Packages %s konnte nicht gelesen werden.%sFehler: %s"

#: lazarusidestrconsts:lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr "Die alte SicherungsFájl %s%s%s konnte nicht gelöscht werden."

#: lazarusidestrconsts:lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr "Kann die unklare Fájl %s%s%s%snicht nach %s%s%s umbenennen."

#: lazarusidestrconsts:lisunabletorenamefile
msgid "Unable to rename file"
msgstr "Konnte die Fájl nicht umbennen"

#: lazarusidestrconsts:lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr "Die Fájl %s%s%s konnte nicht nach %s%s%s umbenannt werden."

#: lazarusidestrconsts:lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr "Die Fájl %s%s%s%s konnte nicht nach %s%s%s umbenannt werden."

#: lazarusidestrconsts:lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Kann Formular im Quelltext nicht umbenennen."

#: lazarusidestrconsts:lisunabletorenamemethodplzfixtheerrorshowninthemessag
msgid "Unable to rename method. Plz fix the error shown in the message window."
msgstr "Konnte die Methode nicht umbennen. Bitte korrigieren Sie den im Ausgabefenster gezeigten Fehler."

#: lazarusidestrconsts:lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Die Változó im Quelltext konnte nicht umbenannt werden."

#: lazarusidestrconsts:lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr "Das Werkzeug %s%s%s:%s%s kann nicht ausgeführt werden"

#: lazarusidestrconsts:lisunabletosavefile
msgid "Unable to save file %s%s%s"
msgstr "Konnte die Fájl %s%s%s nicht speichern"

#: lazarusidestrconsts:lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Kann Ankerseiten-Kontrollelement nicht setzen"

#: lazarusidestrconsts:lisunabletoshowmethodplzfixtheerrorshowninthemessage
msgid "Unable to show method. Plz fix the error shown in the message window."
msgstr "Konnte die Methode nicht anzeigen. Bitte korrigieren Sie den im Meldungsfenster gezeigten Fehler."

#: lazarusidestrconsts:lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Konnte %s nicht streamen: T%s"

#: lazarusidestrconsts:lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Konnte die gewählten Komponenten nicht streamen"

#: lazarusidestrconsts:lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Die ausgewählten Komponenten können nicht gestreamt werder."

#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Konnte binären Komponentenstream von %s für T%s nicht in Text umwandeln."

#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Konnte die CreateForm-Anweisung im Projektquelltext nicht aktualisieren"

#: lazarusidestrconsts:lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr "Konnte Fájl %s%s%s%s nicht schreiben%s."

#: lazarusidestrconsts:lisunabletowritefile
msgid "Unable to write file"
msgstr "Konnte die Fájl nicht schreiben"

#: lazarusidestrconsts:lisunabletowritefile2
msgid "Unable to write file %s%s%s"
msgstr "Konnte die Fájl %s%s%s nicht schreiben"

#: lazarusidestrconsts:lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr "Konnte die Fájl %s%s%snicht schreiben%sFehler: %s"

#: lazarusidestrconsts:lisunabletowritefilename
msgid "Unable to write file %s%s%s."
msgstr "Konnte die Fájl %s%s%s nicht schreiben."

#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr "Konnte Package %s%s%s%snicht in die Fájl %s%s%s schreiben.%sFehler: %s"

#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr "Konnte StatusFájl %s%s%s%sdes Packages %s nicht schreiben.%sFehler: %s"

#: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr "Kann StatusFájl für das Projekt %s nicht schreiben%sFehler: %s"

#: lazarusidestrconsts:lisunabletowritetofile2
msgid "Unable to write to file %s%s%s"
msgstr "Konnte die Fájl %s%s%s nicht schreiben"

#: lazarusidestrconsts:lisunabletowritetofile
msgid "Unable to write to file %s%s%s!"
msgstr "Konnte die Fájl %s%s%s nicht schreiben!"

#: lazarusidestrconsts:dlguncertopt
msgid "Uncertain Optimizations"
msgstr "Bizonytalan Optimalizáció"

#: lazarusidestrconsts:lismenuuncommentselection
msgid "Uncomment selection"
msgstr "Kijelölt megjegyzés feloldása"

#: lazarusidestrconsts:liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Nem jellemzett"

#: lazarusidestrconsts:liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Semmi nem jellemzett"

#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Rekursion zurücknehmen"

#: lazarusidestrconsts:dlgedunder
msgid "Underline"
msgstr "Aláhúzott"

#: lazarusidestrconsts:lismenuundo
msgid "Undo"
msgstr "Visszavonás"

#: lazarusidestrconsts:dlgundoaftersave
msgid "Undo after save"
msgstr "Visszaállítás és mentés"

#: lazarusidestrconsts:dlgundolimit
msgid "Undo limit"
msgstr "Visszaállítás limit"

#: lazarusidestrconsts:srkmecblockunindent
msgid "Unindent block"
msgstr "Blokk kitolása"

#: lazarusidestrconsts:lismenuunindentselection
msgid "Unindent selection"
msgstr "Kijelölt blokk kitolása"

#: lazarusidestrconsts:lispckedituninstall
msgid "Uninstall"
msgstr "Eltávolítás"

#: lazarusidestrconsts:lispckexpluninstallonnextstart
msgid "Uninstall on next start"
msgstr "Eltávolítás a következő indításkor"

#: lazarusidestrconsts:lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Csomag %s eltávolítása?"

#: lazarusidestrconsts:lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Csomag eltávolítása?"

#: lazarusidestrconsts:lisuninstallselection
msgid "Uninstall selection"
msgstr "Kijelölt eltávolítása"

#: lazarusidestrconsts:lispkgfiletypeunit
msgid "Unit"
msgstr "Unit"

#: lazarusidestrconsts:lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr "Unit %s%s%s megváltozott. Menti?"

#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage
msgid "Unit %s%s%s was removed from package"
msgstr "Unit %s%s%s eltávolítva a csomagból"

#: lazarusidestrconsts:lisa2punitfilename2
msgid "Unit File Name:"
msgstr "Unit Fájl név:"

#: lazarusidestrconsts:uemshowunitinfo
msgid "Unit Info"
msgstr "Unit információ"

#: lazarusidestrconsts:lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "Unit név érvénytelen"

#: lazarusidestrconsts:lisa2punitname
msgid "Unit Name:"
msgstr "Unit név:"

#: lazarusidestrconsts:lisaf2punitname
msgid "Unit Name: "
msgstr "Unit név:"

#: lazarusidestrconsts:lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Unit könyvtár"

#: lazarusidestrconsts:lispkgdefsunitpath
msgid "Unit Path"
msgstr "Unit útvonal"

#: lazarusidestrconsts:dlgcounitstyle
msgid "Unit Style:"
msgstr "Unit Stílus:"

#: lazarusidestrconsts:dlgunitdepcaption
msgid "Unit dependencies"
msgstr "Unit függőségek"

#: lazarusidestrconsts:lisa2punitfilename
msgid "Unit file name:"
msgstr "Unit fájl név:"

#: lazarusidestrconsts:lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Unit azonosító létezik"

#: lazarusidestrconsts:lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Unit név létezik"

#: lazarusidestrconsts:lisunitnotfound
msgid "Unit not found"
msgstr "Unit nincs meg"

#: lazarusidestrconsts:lispkgsysunitnotfound
msgid "Unit not found: %s%s%s"
msgstr "Unit nincs meg: %s%s%s"

#: lazarusidestrconsts:dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Unit könyvtár (-FU):"

#: lazarusidestrconsts:lisunitpaths
msgid "Unit paths"
msgstr "Unit útvonal"

#: lazarusidestrconsts:lisunitlfmfile
msgid "Unit: %s%sLFM file: %s"
msgstr "Unit: %s%s.LFM-Fájl: %s"

#: lazarusidestrconsts:lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Unit név létezik"

#: lazarusidestrconsts:lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Ilyen Unit név már van a projektben"

#: lazarusidestrconsts:lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Unitname und Fájlname passen nicht zusammen.%sBeispiel: unit1.pas und Unit1"

#: lazarusidestrconsts:lispeunitname
msgid "Unitname:"
msgstr "Unitnév:"

#: lazarusidestrconsts:lisunitsnotfound2
msgid "Units not found"
msgstr "Units nincs meg"

#: lazarusidestrconsts:lismenuviewunits
msgid "Units..."
msgstr "Unitok ..."

#: lazarusidestrconsts:srvk_unknown
msgid "Unknown"
msgstr "Ismeretlen"

#: lazarusidestrconsts:lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Nem mentett csomag"

#: lazarusidestrconsts:dlgupword
msgid "Up"
msgstr "Fel"

#: lazarusidestrconsts:lisceoupdate
msgid "Update"
msgstr "Frissítés"

#: lazarusidestrconsts:lispckoptsupdaterebuild
msgid "Update/Rebuild"
msgstr "Frissítés/Újrafordítás"

#: lazarusidestrconsts:lismenuuppercaseselection
msgid "Uppercase selection"
msgstr "Kijelölt - nagybetűk"

#: lazarusidestrconsts:lispckoptsusage
msgid "Usage"
msgstr "Használat"

#: lazarusidestrconsts:dlgcoansistr
msgid "Use Ansi Strings"
msgstr "Ansi-Stringek használata"

#: lazarusidestrconsts:lisuseexcludefilter
msgid "Use Exclude Filter"
msgstr "Kizáró szűrő használata"

#: lazarusidestrconsts:dlgcoheaptrc
msgid "Use Heaptrc Unit"
msgstr "Heaptrc Unit használata"

#: lazarusidestrconsts:lisuseincludefilter
msgid "Use Include Filter"
msgstr "Engedélyező szűrő használata"

#: lazarusidestrconsts:dlgusecustomconfig
msgid "Use addional Compiler Config File"
msgstr "Hozzáadott fordító konfig fájl használata"

#: lazarusidestrconsts:dlgedusedefcolor
msgid "Use default color"
msgstr "Alapértelmezett szín"

#: lazarusidestrconsts:dlgrunousedisplay
msgid "Use display"
msgstr "Display használata"

#: lazarusidestrconsts:dlguselaunchingapp
msgid "Use launching application"
msgstr "Indító alkalmazás használata"

#: lazarusidestrconsts:dlgusefpccfg
msgid "Use standard Compiler Config File (fpc.cfg)"
msgstr "Fordító alap konfig fájl használata (fpc.cfg)"

#: lazarusidestrconsts:dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Szintaxis kiemelő használata"

#: lazarusidestrconsts:lispkgmanguseunit
msgid "Use unit"
msgstr "Unit használata"

#: lazarusidestrconsts:rsiwpusewindowmanagersetting
msgid "Use windowmanager setting"
msgstr "Windows beállítások használata"

#: lazarusidestrconsts:srkmecuserfirst
msgid "User First"
msgstr "Benutzer zuerst"

#: lazarusidestrconsts:dlgedcustomext
msgid "User defined extension"
msgstr "felhasználói kiterjesztés"

#: lazarusidestrconsts:dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Felhasználói kiterjesztés (.pp.xxx)"

#: lazarusidestrconsts:dlgrunouseroverrides
msgid "User overrides"
msgstr "Felülbírálás"

#: lazarusidestrconsts:dlgvaluecolor
msgid "Value"
msgstr "Érték"

#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Fájl útvonalak"

#: lazarusidestrconsts:liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Szöveg"

#: lazarusidestrconsts:dlgrunovariable
msgid "Variable"
msgstr "Változó"

#: lazarusidestrconsts:lisctdefvariablename
msgid "Variable Name"
msgstr "Változó név"

#: lazarusidestrconsts:dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Változónpräfix"

#: lazarusidestrconsts:liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Változó:"

#: lazarusidestrconsts:lisctdefvariable
msgid "Variable: %s"
msgstr "Változó: %s"

#: lazarusidestrconsts:dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Kompilationsausgaben:"

#: lazarusidestrconsts:lisversion
msgid "Version"
msgstr "Verzió"

#: lazarusidestrconsts:versioninfotitle
msgid "Version Info"
msgstr "Verzió Információ"

#: lazarusidestrconsts:lisvertical
msgid "Vertical"
msgstr "Függőleges"

#: lazarusidestrconsts:dlggridyhint
msgid "Vertical grid step size"
msgstr "Függőleges rácsméret"

#: lazarusidestrconsts:lismenuviewanchoreditor
msgid "View Anchor Editor"
msgstr "Objektum horgony szerkesztő"

#: lazarusidestrconsts:uemviewcallstack
msgid "View Call Stack"
msgstr "Veremhívás"

#: lazarusidestrconsts:srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Kód intéző"

#: lazarusidestrconsts:lismenuviewcomponentpalette
msgid "View Component Palette"
msgstr "Komponenspaletta"

#: lazarusidestrconsts:srkmectogglelazdoc
msgid "View Documentation Editor"
msgstr "Forráskódszerkesztő"

#: lazarusidestrconsts:lishintviewforms
msgid "View Forms"
msgstr "Formok"

#: lazarusidestrconsts:lismenuviewidespeedbuttons
msgid "View IDE speed buttons"
msgstr "Gyorsgombok"

#: lazarusidestrconsts:lismenuviewjumphistory
msgid "View Jump-History ..."
msgstr "Ugrás előzmények ..."

#: lazarusidestrconsts:srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Objektum felügyelő"

#: lazarusidestrconsts:lispckeditviewpackgesource
msgid "View Package Source"
msgstr "Csomag forráskód"

#: lazarusidestrconsts:lisviewprojectunits
msgid "View Project Units"
msgstr "Projekt unitok"

#: lazarusidestrconsts:srkmectogglesearchresults
msgid "View Search Results"
msgstr "Keresési találatok megjelenítése"

#: lazarusidestrconsts:lismenuviewsource
msgid "View Source"
msgstr "Projekt Forráskód megjelenítése"

#: lazarusidestrconsts:lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Forráskód (.lfm) megjelenítése"

#: lazarusidestrconsts:srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Forráskódszerkesztő"

#: lazarusidestrconsts:lismenuviewprojecttodos
msgid "View ToDo List ..."
msgstr "ToDo Lista ..."

#: lazarusidestrconsts:lismenuviewunitdependencies
msgid "View Unit Dependencies"
msgstr "Unit függőségek megjelenítése"

#: lazarusidestrconsts:liskmviewunitinfo
msgid "View Unit Info"
msgstr "Unit információk megjelenítése"

#: lazarusidestrconsts:lismenuviewunitinfo
msgid "View Unit Information"
msgstr "Unit információk megjelenítése"

#: lazarusidestrconsts:lishintviewunits
msgid "View Units"
msgstr "Unitok"

#: lazarusidestrconsts:srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Horgony szerkesztő"

#: lazarusidestrconsts:srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Megszakítás pontok"

#: lazarusidestrconsts:srkmectogglecallstack
msgid "View call stack"
msgstr "Verem hívás"

#: lazarusidestrconsts:srkmectogglecodebrowser
msgid "View code browser"
msgstr "Kód böngésző"

#: lazarusidestrconsts:srkmectogglecomppalette
msgid "View component palette"
msgstr "Komponens paletta"

#: lazarusidestrconsts:srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Hibakereső kimenet"

#: lazarusidestrconsts:srkmecviewforms
msgid "View forms"
msgstr "Formok"

#: lazarusidestrconsts:liskmviewjumphistory
msgid "View jump history"
msgstr "Ugrás történet"

#: lazarusidestrconsts:srkmectogglelocals
msgid "View local variables"
msgstr "Helyi változók"

#: lazarusidestrconsts:srkmcatviewmenu
msgid "View menu commands"
msgstr "Menü parancsok"

#: lazarusidestrconsts:srkmectogglemessages
msgid "View messages"
msgstr "Üzenetek"

#: lazarusidestrconsts:liskmviewprojecttodolist
msgid "View project ToDo list"
msgstr "Projekt ToDo lista"

#: lazarusidestrconsts:dlgmainviewforms
msgid "View project forms"
msgstr "Projekt Formok"

#: lazarusidestrconsts:liskmviewprojectoptions
msgid "View project options"
msgstr "Projekt beállítások"

#: lazarusidestrconsts:liskmviewprojectsource
msgid "View project source"
msgstr "Projekt forráskód"

#: lazarusidestrconsts:dlgmainviewunits
msgid "View project units"
msgstr "Projekt unitok"

#: lazarusidestrconsts:srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Unitfüggőségek"

#: lazarusidestrconsts:srkmecviewunitinfo
msgid "View unit information"
msgstr "Unit információk megjelenítése"

#: lazarusidestrconsts:srkmecviewunits
msgid "View units"
msgstr "Unitok"

#: lazarusidestrconsts:srkmectogglewatches
msgid "View watches"
msgstr "Változó figyelő"

#: lazarusidestrconsts:lishlpoptsviewers
msgid "Viewers"
msgstr "Nézőke"

#: lazarusidestrconsts:lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Virtuális Unit"

#: lazarusidestrconsts:lisaf2pisvirtualunit
msgid "Virtual unit (source is not in package)"
msgstr "Virtuális Unit (A forrást nem tartalmazza a csomag)"

#: lazarusidestrconsts:dlgvisiblegutter
msgid "Visible gutter"
msgstr "Sichtbare Randleiste"

#: lazarusidestrconsts:dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Jobb margó látszik"

#: lazarusidestrconsts:dlgambigwarn
msgid "Warn on compile"
msgstr "Fordításkor figyelmeztetés"

#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Figyelem: Die zusätzliche CompilerkonfigurationsFájl besitzt den gleichen Namen wie eine der Standard-KonfigurationsFájlen nach denen der Free-Pascal-Compiler sucht. Das kann dazu führen, daß NUR diese und nicht die Standard-Fájl verwendet wird."

#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr "Figyelem: A Fájl %s%s%s%saz aktuális Projekthez tartozik."

#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr "Figyelem: Nem egyértelmű fájl: %s%s%s. A forrásfájl: %s%s%s"

#: lazarusidestrconsts:liswlwatchlist
msgid "Watch list"
msgstr "Változó lista"

#: lazarusidestrconsts:lismenuviewwatches
msgid "Watches"
msgstr "Változó figyelő"

#: lazarusidestrconsts:dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "Ha új formot hoz létre, adja hozzá az automatikusan létrehozott formokhoz"

#: lazarusidestrconsts:lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Fájlra kapcsoláskor a Forráskódszerkesztőben"

#: lazarusidestrconsts:lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor ..."
msgstr "Ha ez a fájl aktív a forráskód szerkesztőben..."

#: lazarusidestrconsts:lisfindfilewhere
msgid "Where"
msgstr "Ahol"

#: lazarusidestrconsts:dlgwholewordsonly
msgid "Whole Words Only"
msgstr "Csak teljes kifejezés"

#: lazarusidestrconsts:lisfindfilewholewordsonly
msgid "Whole words only"
msgstr "Csak teljes kifejezés"

#: lazarusidestrconsts:dlgwidthpos
msgid "Width:"
msgstr "Szélesség:"

#: lazarusidestrconsts:lisdebugoptionsfrmwindow
msgid "Window"
msgstr "Ablak"

#: lazarusidestrconsts:dlgwinpos
msgid "Window Positions"
msgstr "Ablak pozíció"

#: lazarusidestrconsts:dlgwindows
msgid "Windows"
msgstr "Ablakok"

#: lazarusidestrconsts:lislazbuildwithstaticpackages
msgid "With Packages"
msgstr "Csomagokkal"

#: lazarusidestrconsts:liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Wort an der aktuellen Cursorposition im Editor"

#: lazarusidestrconsts:srkmecwordcompletion
msgid "Word completion"
msgstr "Kifejezés kiegészítés"

#: lazarusidestrconsts:dlgwordspolicies
msgid "Words"
msgstr "Kifejezések"

#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath2
msgid "Working Directory (Leave empty for file path)"
msgstr "Munkakönyvtár (Útvonal nélkül)"

#: lazarusidestrconsts:lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Munkakönyvtár:"

#: lazarusidestrconsts:dlgroworkingdirectory
msgid "Working directory"
msgstr "Munkakönyvtár"

#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (Leave empty for file path)"
msgstr "Munkakönyvtár (Útvonal nélkül)"

#: lazarusidestrconsts:lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Fordítás munkakönyvtára"

#: lazarusidestrconsts:lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Futtatás munkakönyvtára"

#: lazarusidestrconsts:liswriteerror
msgid "Write Error"
msgstr "Írás hiba"

#: lazarusidestrconsts:dlgwritefpclogo
msgid "Write an FPC logo"
msgstr "FPC-Logo hozzáírása"

#: lazarusidestrconsts:liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Írás hiba"

#: lazarusidestrconsts:dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Präfix schreiben"

#: lazarusidestrconsts:lisxmlfiles
msgid "XML files"
msgstr "XML fájlok"

#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You can not build lazarus while debugging or compiling."
msgstr "A Lazarus nem fordítható, amíg hibakeresés, vagy programfordítás folyik."

#: lazarusidestrconsts:dlgdoesnotexist
msgid "\" does not exist."
msgstr "\" nincs meg."

#: lazarusidestrconsts:uefilerotext2
msgid "\" is not writable."
msgstr "\" nem írható."

#: lazarusidestrconsts:srkmecabortbuild
msgid "abort build"
msgstr "Fordítás megszakítása"

#: lazarusidestrconsts:srkmecaddbreakpoint
msgid "add break point"
msgstr "Új megszakítási pont"

#: lazarusidestrconsts:srkmecaddwatch
msgid "add watch"
msgstr "Új Változó hozzáadása"

#: lazarusidestrconsts:srvk_apps
msgid "application key"
msgstr "Alkalmazás billentyű"

#: lazarusidestrconsts:lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "automatikus, dinamikus telepítés"

#: lazarusidestrconsts:lisoipautoinstallstatic
msgid "auto install static"
msgstr "automatikus, statikus telepítés"

#: lazarusidestrconsts:srkmecbuildall
msgid "build all files of program/project"
msgstr "A program/projekt összes fájljának fordítása"

#: lazarusidestrconsts:srkmecbuildfile
msgid "build file"
msgstr "Fájl fordítása"

#: lazarusidestrconsts:srkmecbuild
msgid "build program/project"
msgstr "Program/Projekt fordítás"

#: lazarusidestrconsts:dlglefttopclr
msgid "color for left, top"
msgstr "Bal felső szín"

#: lazarusidestrconsts:dlgrightbottomclr
msgid "color for right, bottom"
msgstr "Jobb alsó szín"

#: lazarusidestrconsts:srkmeccompileroptions
msgid "compiler options"
msgstr "Fordító beállítások"

#: lazarusidestrconsts:liscodetoolsdefscompilerpath
msgid "compiler path"
msgstr "Fordító útvonal"

#: lazarusidestrconsts:srkmecconfigbuildfile
msgid "config build file"
msgstr "Konfiguriere ErstellungsFájl"

#: lazarusidestrconsts:liscustomoptions
msgid "custom options"
msgstr "Egyéb beállítások"

#: lazarusidestrconsts:liscodefault
msgid "default (%s)"
msgstr "alapértelmezett (%s)"

#: lazarusidestrconsts:srkmecevaluate
msgid "evaluate/modify"
msgstr "kiértékel/módosít"

#: lazarusidestrconsts:lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "Fájl, in die Debug-Ausgaben geschrieben werden. Falls nichts angegeben ist, werden Debug-Ausgaben auf die Konsole geschrieben."

#: lazarusidestrconsts:lisuidinproject
msgid "in Project:"
msgstr "a Projektben:"

#: lazarusidestrconsts:lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "minden nyitott csomagban és Projektben"

#: lazarusidestrconsts:lisfriincurrentunit
msgid "in current unit"
msgstr "az aktuális unitban"

#: lazarusidestrconsts:lisfriinmainproject
msgid "in main project"
msgstr "a fő projektben"

#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "im Projekt/Package dem die aktuelle Unit gehört"

#: lazarusidestrconsts:lisincludepath
msgid "include path"
msgstr "Include útvonal"

#: lazarusidestrconsts:srkmecinspect
msgid "inspect"
msgstr "Ellenőrzés"

#: lazarusidestrconsts:lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "dinamikus telepítés"

#: lazarusidestrconsts:lisoipinstalledstatic
msgid " installed static"
msgstr "statikus telepítés"

#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "érvénytelen fordító fájlnév"

#: lazarusidestrconsts:lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [beállítások] <Projekt Fájl név>"

#: lazarusidestrconsts:srvk_lwin
msgid "left windows key"
msgstr "Bal ablak billentyű"

#: lazarusidestrconsts:lislibrarypath
msgid "library path"
msgstr "könyvtár útvonal"

#: lazarusidestrconsts:lislinkeroptions
msgid "linker options"
msgstr "Linker beállítás"

#: lazarusidestrconsts:dlgcdtlower
msgid "lowercase"
msgstr "kisbetű"

#: lazarusidestrconsts:lisprojectmacrounitpath
msgid "macro ProjectUnitPath"
msgstr "Makro ProjectUnitPath"

#: lazarusidestrconsts:lisoipmissing
msgid "missing"
msgstr "hiányzó"

#: lazarusidestrconsts:lisoipmodified
msgid "modified"
msgstr "módosított"

#: lazarusidestrconsts:lisuidno
msgid "no"
msgstr "Nem"

#: lazarusidestrconsts:dlgnoautomaticrenaming
msgid "no automatic renaming"
msgstr "Nincs automatikus átnevezés"

#: lazarusidestrconsts:lisnoname
msgid "noname"
msgstr "névtelen"

#: lazarusidestrconsts:lisnone2
msgid "none"
msgstr "nincs"

#: lazarusidestrconsts:liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "Nincs kijelölt"

#: lazarusidestrconsts:lisobjectpath
msgid "object path"
msgstr "Objektum útvonal"

#: lazarusidestrconsts:lisor
msgid "or"
msgstr "vagy"

#: lazarusidestrconsts:lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "Csomag %s nincs mentve"

#: lazarusidestrconsts:lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "Csomag Fő forrás fájl"

#: lazarusidestrconsts:srkmecpause
msgid "pause program"
msgstr "Program szünetel"

#: lazarusidestrconsts:lisctpleaseselectamacro
msgid "please select a macro"
msgstr "Válasszon egy makrót"

#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr "primäres Konfigurationsverzeichnis in dem Lazarus seine KonfigurationsFájlen speichert. Voreinstellung ist"

#: lazarusidestrconsts:srkmecquickcompile
msgid "quick compile, no linking"
msgstr "gyors fordítás, linkelés nélkül"

#: lazarusidestrconsts:lisoipreadonly
msgid "readonly"
msgstr "csak olvasható"

#: lazarusidestrconsts:srkmecremovebreakpoint
msgid "remove break point"
msgstr "megszakítási pont eltávolítás"

#: lazarusidestrconsts:srkmecresetdebugger
msgid "reset debugger"
msgstr "Hibakereső visszaállítás"

#: lazarusidestrconsts:srvk_rwin
msgid "right windows key"
msgstr "Jobb ablak billentyű"

#: lazarusidestrconsts:srkmecrunfile
msgid "run file"
msgstr "Fájl futtatás"

#: lazarusidestrconsts:srkmecrunparameters
msgid "run parameters"
msgstr "Futtatási paraméterek"

#: lazarusidestrconsts:srkmecrun
msgid "run program"
msgstr "Program futtatás"

#: lazarusidestrconsts:lissaveallmodified
msgid "save all modified files"
msgstr "Minden mentése"

#: lazarusidestrconsts:lissavecurrenteditorfile
msgid "save current editor file"
msgstr "Aktuális szerkesztett fájl mentése"

#: lazarusidestrconsts:lisfindfilesearchallfilesinproject
msgid "search all files in project"
msgstr "Keresés a Projekt minden fájljában"

#: lazarusidestrconsts:lisfindfilesearchallopenfiles
msgid "search all open files"
msgstr "Keresés minden megnyitott fájlban"

#: lazarusidestrconsts:lisfindfilesearchindirectories
msgid "search in directories"
msgstr "Keresés könyvtárakban"

#: lazarusidestrconsts:dlgtimesecondunit
msgid "sec"
msgstr "mp"

#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr "sekundäres Konfigurationsverzeichnis in dem Lazarus nach Konfigurationsschalblonen sucht. Voreinstellung ist"

#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "Delphi kompatibilis mód"

#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "GPC-Kompatibilis mód"

#: lazarusidestrconsts:lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "Turbo Pascal Kompatibilis mód"

#: lazarusidestrconsts:lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "I/O ellenőrzés be"

#: lazarusidestrconsts:lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "Túlcsordulás ellenőrzés be"

#: lazarusidestrconsts:lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "Értékhatár ellenőrzés be"

#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "KonfigurationsFájl für statische Packages"

#: lazarusidestrconsts:srkmecstopprogram
msgid "stop program"
msgstr "Program állj"

#: lazarusidestrconsts:listhishelpmessage
msgid "this help message"
msgstr "Ez súgó üzenet"

#: lazarusidestrconsts:lisunitpath
msgid "unit path"
msgstr "Unit útvonal"

#: lazarusidestrconsts:srkmecunknown
msgid "unknown editor command"
msgstr "Ismeretlen szerkesztő parancs"

#: lazarusidestrconsts:lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "Verwende Unit HeapTrc"

#: lazarusidestrconsts:lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "LineInfo Unit használata"

#: lazarusidestrconsts:lisuidyes
msgid "yes"
msgstr "igen"

